File size: 1,549 Bytes
1f979bf 2839395 3975a11 2839395 |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 |
---
license: mit
---
# ESM-2 for Predicting Binding Sites
## Using the Model
```python
from transformers import AutoModelForTokenClassification, AutoTokenizer
from peft import PeftModel
import torch
# Path to the saved LoRA model
model_path = "AmelieSchreiber/esm2_t33_650M_qlora_binding_12M"
# ESM2 base model
base_model_path = "facebook/esm2_t33_650M_UR50D"
# Load the model
base_model = AutoModelForTokenClassification.from_pretrained(base_model_path)
loaded_model = PeftModel.from_pretrained(base_model, model_path)
# Ensure the model is in evaluation mode
loaded_model.eval()
# Load the tokenizer
loaded_tokenizer = AutoTokenizer.from_pretrained(base_model_path)
# Protein sequence for inference
protein_sequence = "MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT" # Replace with your actual sequence
# Tokenize the sequence
inputs = loaded_tokenizer(protein_sequence, return_tensors="pt", truncation=True, max_length=1024, padding='max_length')
# Run the model
with torch.no_grad():
logits = loaded_model(**inputs).logits
# Get predictions
tokens = loaded_tokenizer.convert_ids_to_tokens(inputs["input_ids"][0]) # Convert input ids back to tokens
predictions = torch.argmax(logits, dim=2)
# Define labels
id2label = {
0: "No binding site",
1: "Binding site"
}
# Print the predicted labels for each token
for token, prediction in zip(tokens, predictions[0].numpy()):
if token not in ['<pad>', '<cls>', '<eos>']:
print((token, id2label[prediction]))
``` |