text
stringlengths 1
940k
⌀ | target
stringclasses 2
values |
|---|---|
A COURT TOLD Lovin’ Dublin on Friday to remove an online review published last month about Kokoro Sushi Bento, a restaurant on South William Street.
The legal proceedings were initiated by the sushi business following the publication of the article which made a number of unverified claims.
Stewart & Ino Solicitors, acting for the plaintiffs, told TheJournal.ie that the mandatory injunction was obtained on Friday afternoon and the piece was removed from the site.
The review, written by the site’s owner Niall Harbison, was shared hundreds of times on Facebook.
The publishers have also been told to remove all references to the piece on social media and to work with Google to ensure against cached searches.
The food company had initially just sought for the review to be removed from the Lovin’ Dublin site which has a significant following. However, it may now also look for an apology, costs and either compensation or a donation to charity.
Solicitors for the eatery said that the review has “caused considerable losses to the business”.
Harbison told TheJournal.ie that he could not comment on the case as legal proceedings had been taken. He confirmed that Lovin’ Dublin were complying with the injunction.
More recently, Kokoro has received some good press from international wrestling star Sheamus. | positive |
Watch what happens when you bend a foldable phone past its breaking point News News Events TNW Conference 2023 June 16 & 17, 2022 TNW València 2023 All events Spaces Programs Newsletters Partner with us Jobs Contact News news news news Latest Gadgets & apps AI & futurism EVs & mobility Startups & growth Crypto & fintech Careers in tech More Future of Finance Read Me This article was published on July 29, 2019 Gear Watch what happens when you bend a foldable phone past its breaking point It breaks July 29, 2019 - 8:32 pm Story by Napier Lopez Story by Napier Lopez Reporter Napier Lopez is a writer based in New York City. He's interested in all things tech, science, and photography related, and likes to yo-yo in (show all) Napier Lopez is a writer based in New York City. He's interested in all things tech, science, and photography related, and likes to yo-yo in his free time. Follow him on Twitter. YouTuber JerryRigEverything‘s claim to fame is his collection of phone torture tests – especially the parts where he tries to break a phone by bending it with his beefy arms. But what happens when that phone is actually meant to bend? At first, it seems the perfect foible, until you remember bendable phones are only meant to bend one way. The star of this most recent bit of tech gore is the Royole Flexpie, a phone that beat Samsung and Huawei to the punch in making the world’s first foldable phone. You can watch the whole thing below before reading on if you want to avoid spoilers: Join TNW in Valencia! The heart of tech is coming to the heart of the Mediterranean Read more Before the folding test, JerruRigEverything – who’s real name is Zack Nelson – goes through his usual gamut of other tests. While almost every other modern phone “scratches at a level 6 with grooves at a level seven” – requiring something harder than simple keys or most metals – we can see the plastic screen of the Flexpie scratches much more easily. This is to be expected, as no one has quite figured out how to make glass foldable yet, though Corning is working on it. For the time being, you can expect this to be the case with every folding phone, though as Nelson points out, phones that fold the display inwards are obviously much more protected from stay materials in your pocket. When we finally get to the bend test, we obviously have no concerns about the phone folding the way it’s supposed to bend. But when Nelson tries bending the phone the opposite direction, the Flexpie puts up a good fight. When it does eventually crack, however, it’s the hinge that fails rather than the display, because, you know… it’s bendable. Unfortunately, the display does eventually get damaged too due to the lack of rear support, but it goes to show that in this respect, at least, flexible displays have an advantage over regular ones. You might be keeping an eye out for scratches more often, but you probably won’t have to worry about permanent damage to the screen every time you drop your phone. Now, if only Samsung and Huawei could hurry up… Get the TNW newsletter Get the most important tech news in your inbox each week. Follow @thenextweb Also tagged with Smartphone Bend Published July 29, 2019 - 8:32 pm UTC Back to top Popular on Plugged 1 An easy guide to ruining your MacBook’s battery 2 What the hell is Apple’s butterfly keyboard? 3 How to stop your Apple Watch stupidly announcing exercise details 4 How to check if a Mac app runs on Rosetta or M1 5 How to stream Spotify at the best possible quality Related Articles plugged Samsung Galaxy Unpacked happens August 11 — here’s what to expect plugged Everything Samsung announced at its Galaxy S22 event See who you could meet in 2023! Check out the TNW Conference 2022 post-show report → Download now plugged Take 15 seconds of your time to watch a drone fly by an erupting volcano plugged Small Android phones could be huge — but only if they’re cheap The heart of tech More TNW Media Events Programs Spaces Newsletters Deals About TNW Partner with us Jobs Terms & Conditions Cookie Statement Privacy Statement Editorial Policy Masthead Copyright © 2006—2022, The Next Web B.V. Made with <3 in Amsterdam. | negative |
In a dramatic twist to the Sunanda Pushkar death case, the Delhi Police confirmed on Tuesday that she was murdered, with the medical board calling her death 'unnatural'.
According to Times Now, Delhi Police commissioner BS Bassi has said that a case of murder will be registered soon.
A year after the death of MP Shashi Tharoor's wife, the Medical Board said that her death was 'unnatural' and was because of poisoning.
ANI quoted Bassi as saying, "Medical report says she was poisoned, oral or injected we do not know, it is being investigated."
"We have to investigate whether she poisoned herself or whether she was forcefully given poison," Bassi told the media.
"We are taking all necessary measures in the case. It is clear that Sunanda Pushkar's death was not natural," Bassi said and added, "The Post-mortem report does not say whether poison was taken or injected. Need to send samples abroad for further tests."
CNN-IBN reported that an FIR has been registered under Section 302 (murder) and other relevant sections. "The FIR is not against any particular person," Bassi said.
"We can only say which substance caused the poisoning after further investigation," Bassi said.
The police also said that Shashi Tharoor will be questioned.
Pushkar was found dead in her hotel room number 345 of the Leela Palace in New Delhi's Chanakyapuri. Her body was found by her husband Shashi Tharoor.
Firstpost is now on WhatsApp. For the latest analysis, commentary and news updates, sign up for our WhatsApp services. Just go to Firstpost.com/Whatsapp and hit the Subscribe button. | positive |
Fox Business host Stuart Varney (screen grab)
Stuart Varney, one of the most conservative hosts at Fox Business, expressed his frustration with Donald Trump’s losing campaign on Monday.
During a segment about Trump’s “Contract with American Voters”, Varney noted that many Americans had never heard of the plan because the billionaire had focused his speech in Gettysburg on attacking the women who had accused him of groping.
“The so-called Gettysburg Address, he raises the issue of suing his women accusers,” Varney complained to Trump economic adviser David Malpass. “He raises the issue of suing his women accusers. He brings these women back into the picture. I mean, come on! This is a tragedy for America.”
Malpass pivoted to attack Hillary Clinton’s job program, which he said means “the government is going to take over your life.”
“I’m with you all the way,” Varney agreed. “Growth and prosperity.”
“Let’s talk about those every day,” Malpass suggested.
“Have him talk about it!” Varney exclaimed. “Have him pound the table for prosperity and growth. Please!”
“One of the problems is the corruption in Washington,” Malpass insisted.
“No,” Varney snapped. “One of the problems is your candidate who can’t stay away from talking about women and his accusers.”
Watch the video below from Fox Business, broadcast Oct. 24, 2016. | positive |
The actor debuted as Cyborg in 'Batman v Superman: Dawn of Justice.'
Justice League star Ray Fisher has signed with CAA.
The actor, who will play Cyborg in Warner Bros.’ DC Comics team-up, left his former representation, ICM Partners and Brookside Artist Management, in January.
Fisher, who earned raves as Muhammad Ali in a 2013 off-Broadway production of Fetch Clay, Make Man, was cast as Cyborg in April 2014 and made his debut in 2016’s Batman v Superman: Dawn of Justice.
He'll next be seen in Justice League, which also stars Henry Cavill, Gal Gadot, Ben Affleck, Jason Momoa and Ezra Miller, and hits theaters in November. He was slated to appear in the Warner Bros. film The Flash, which was aiming to start production in March 2017 with a March 16, 2018, release date but was postponed after director Rick Famuyiwa departed the film last November, citing creative differences. It remains without a director.
Fisher also is attached to a stand-alone Cyborg movie, but the film does not yet have a writer or director.
He continues to be represented by his lawyer David Weber of Sloane, Offer, Weber & Dern. | positive |
Sadaf Pomegranate Molasses | Food is Personal Blog Just the Words Home About Contact Me Search for: Skip to content Food is Personal But meant to be shared Blog Just the Words Home About Contact Me Tag: Sadaf Pomegranate Molasses Fasenjan, Persian Walnut Pomegranate Chicken, Feast Food by Alex Gardner on November 12, 2020 November 25, 2020 Fesenjan is a feast dish that is traditionally eaten during the Persian holiday Shab-e Yalda, to celebrate the winter solstice and is a pre-Islamic celebration. Search for: Recent Posts Walk and Eat with this Aussie Style Meat Pie A Guiso by any Other Name Tasty Sourdough Bacon Cheese Batard is Addictive My Aus-Ion Wrought Iron Pan Review and Seasoning Make Tasty Smoky Peruano Beans with Pork Neck Bones Archives February 2021 January 2021 December 2020 November 2020 October 2020 September 2020 August 2020 Categories Blog Breakfast desert Dinner Equipment Focaccia Just the Words Lunch Salad Salsa Sourdough Uncategorized Copyright © 2022 Food is Personal. All Rights Reserved. Fooding Theme by FRT Enjoy this blog? Please spread the word :) | negative |
Crystal Palace are pleased to announce the signing of England under-21 international Patrick Bamford from Chelsea on a season-long loan deal.
The 21-year-old striker arrives from the Blues having starred at Middlesbrough last season where he scored 17 times in the Championship and named the division’s Player of the Year.
Bamford becomes the Club’s second summer signing after the arrival of Yohan Cabaye earlier this month.
Commenting on his signing, Bamford said, “I was quite keen to stay close to London this time and Palace were actually my first choice, but I didn't realise they were keen to start with. Then, when I met with the manager, he put forward his plans and it was an easy decision."
The England under-21 added, “I like to get in behind the defence. I'd say I'm deceptively quick, but I'm sure they'll make their own minds up! I do like to score goals, so hopefully I'll be able to do that a lot here. I want to try to establish myself in a Premier League team and if I can do that here then it would be great for me and great for the club.”
Eagles manager Alan Pardew was delighted by the young forward’s decision to join the club for the season.
“It’s a coup for Crystal Palace ahead of a host of rivals,” he said. “I’m so pleased he chose us over others to help develop his game. Hopefully he will be a star for us, Chelsea and – of course – England.
“Patrick is one of England’s brightest prospects and I will liaise with Jose [Mourinho], Gareth [Southgate] and Dan Ashworth on his progress during this important year in his career.”
Bamford began his career at Nottingham Forest where he progressed through their Academy and played twice for the first-team before being signed by Chelsea for £1.5 million in January 2012. He then enjoyed a couple of loan spells with MK Dons between 2012 and 2014, where he scored 21 goals in 44 games in League One and more recently in the Championship for Derby County where he played the second half of 2013/14, as the Rams narrowly missed out on promotion to the Premier League.
Last season saw him move to Teeside where he was an instant success, scoring 19 times in all competitions including once against Manchester City in the FA Cup where Boro pulled off an upset win at the Etihad Stadium.
As well as representing his country at under-21 level, he has also played for the Three Lions at under-18 and under-20 levels. He was included in Gareth Southgate’s squad for the UEFA Under-21 Championships this summer but missed out on the tournament through injury.
| positive |
Boskernovel fiction – Chapter 1299 – An Old Enemy elfin weary -p1 – Nadine Plus Skip to content Nadine Plus Sample Page Boskernovel fiction – Chapter 1299 – An Old Enemy elfin weary -p1 Posted on September 1, 2022 by Durwin Angelica fiction My Vampire System – Chapter 1299 – An Old Enemy slap telling -p1 Vrouw Grobelaar and Her Leading Cases Novel–My Vampire System–My Vampire System Chapter 1299 – An Old Enemy slope wipe Often, the effect competency will be additional immediate with extracting info within one, leading to Quinn to inquire about several queries. socrates ‘Quinn, I don’t like asking for numerous favours, however i consider there might be a little something I can do. Get me to Jim, i want to talk to him.’ Vincent required. ‘Quinn, I don’t like asking you for numerous favours, but I consider there can be one thing I will do. Consider me to Jim, permit me to speak to him.’ Vincent asked. Genuinely, Vorden when returning right here didn’t consider he essential to do significantly persuasive on the a pair of them, he thought it was crystal clear that this overall mission ended up being one huge failing, but there was a particular try looking in Quinn’s eyeball with that being said he wasn’t preparing to return. ‘Quinn, I don’t like asking for numerous favours, nevertheless i believe there could possibly be a little something I will do. Consider me to Jim, permit me to speak to him.’ Vincent asked for. Last but not least, after what appeared like never-ending preventing to Quinn, he could show that the Masked were definitely beginning to compromise straight down. Much more, also, he realized that no other Cursed faction subscribers seemed to be in danger. Right now no less than, that had been why Quinn was able to carry on thinning their figures although strengthening themselves. phaedrus bakugan Frequently, the effect talent could be a lot more straight with extracting information and facts from a single, resulting in Quinn to question numerous queries. Finding this, there had been a little something bothering him, why would the humans be working with Jim to start with. From just this very much, Vorden knew what Quinn wished to know. “A six spiked Dalki?” Quinn questioned, having trouble thinking it. He clenched his fist, attempting to bear in mind what he could do against one, if he obtained previously been powerless when in front of Slicer without the assistance of the Blades. How could he fare against the six spike? From just this considerably, Vorden recognized what Quinn needed to know. “What have you say?” Vorden questioned from regarding. “I assumed the Rotor blades were definitely those that got become reduce the Truedream household? Didn’t they retaliate following attacking?” the modigliani scandal ken follet Each of which viewed Quinn for some seconds, just before they started to head off in the other route. “I am going to get them to pay for getting his life!” “Vorden!’ Quinn shouted out, just before he fully kept. “Who was it?” For the time being, the others obtained shared with Quinn anything they necessary, Vorden had informed him of what all of those other Cursed faction have been doing, and Peter obtained up-to-date that which was transpiring with Eno and Richard. “I do believe there may be still anything I could do… no, that I have to do. Don’t bother about me, with all the Shadow skill, I will move to one of you minus the teleporter. Have Peter and this also man together with you, I believe he might possess some more info for many people.” sun and saddle leather “The others, they’re under assault!” Quinn called out. “All of those other Masked must be assaulting the men at the temple. You need to hurry up, they will likely demand your support! Top of your head directly back to the Cursed s.h.i.+p, it’s a purchase order!” Each of which fully understood, plus it appeared like furthermore they wished to stay with Quinn, that had been until Quinn could feel a link inside him once more. “Whoa, After all I thought I needed destroyed a good deal, but Quinn what have you do?” Peter required when he experienced a field brimming with old systems. ‘Quinn, I don’t like asking for countless favours, nevertheless i assume there could possibly be a little something I could do. Take me to Jim, let me speak to him.’ Vincent requested. The 2 of them checked out Quinn for a few a few moments, right before they started to go off from the other route. Last but not least, immediately after what appeared like endless dealing with to Quinn, he could explain to that the Masked have been starting to resolve lower. Much more, also, he pointed out that no other Cursed faction subscribers seemed to be in danger. At the moment at the very least, which has been why Quinn was able to carry on thinning their phone numbers when healing him self. Both the ones realized, and it also looked like furthermore they wanted to keep with Quinn, that had been until Quinn could sense a link inside him once again. ‘d.a.m.n it, it seems like I may have squandered too much effort upon you men!’ Quinn idea, not anymore caring about while using the Shadow eater to boost his MC tissue marginally and as a substitute went to finish off each of them off quickly preferably. The Undefined Love Normally, the affect skill can be even more strong with removing facts within one, producing Quinn to ask a number of issues. “Be sure to don’t get rid of me, we were compelled to are available in this article, We had been informed to combat! Or else if we didn’t we might be destroyed!” It checked just like a fairly younger male, older than Quinn him self on his later twenties. ‘Quinn, I don’t like asking for so many favours, although i consider there could be a little something I can do. Acquire me to Jim, permit me to speak with him.’ Vincent requested. Gudrid the Fair Soon after studying that individuals Masked ended up merely clones of Jim, Quinn noticed far more at ease getting rid of them, and through his minor ma.s.sacre he obtained also found out some other suggestions with regards to the Masked. “Whoa, I am talking about I thought I had wiped out a lot, but Quinn what have you do?” Peter required because he went through an industry brimming with lifeless bodies. ***** The Pirates’ Who’s Who “T-truedream! Y-you have to have heard about our family members identity ahead of, correct?” The man stuttered slightly in anxiety. “No I’m absolutely sure you possess, we, the people, each of us the following are the ones that employed to fit in with the Truedream family! “ “I believe there is certainly still one thing I can do… no, i always should do. Don’t be worried about me, together with the Shadow power, I will visit certainly one of you even without the teleporter. Acquire Peter and this gentleman along, I believe he may have some more information for all of us.” “Let me know who you are. What have you figured out regarding the guy you will be working for and precisely why are you here?” Quinn questioned, ever since the guy already appeared to be happy to articulate, Quinn didn’t feel the need to utilize the Have an impact on expertise whatsoever. Primarily considering that he was pressed for time. Posted in Uncategorized Post navigation Lovelynovel My Vampire System novel – Chapter 1313 – Eno’s Surprise fearful suspect to you-p3 Brilliantnovel fiction – Chapter 1268 – I’m Evil toad sturdy recommend-p1 Leave a Reply Cancel reply Your email address will not be published. Required fields are marked * Save my name, email, and website in this browser for the next time I comment. Recent Posts Topgallantfiction Nanomancer Reborn – I’ve Become A Snow Girl?blog – Chapter 966 Shiro And Syradil maddening imaginary -p1 Gallowsfiction – Chapter 645 Top Of Mount Olympus excuse pull -p3 Prestantiousfiction Nanomancer Reborn – I’ve Become A Snow Girl? – Chapter 851 Priscera apologise gold propose-p1 Supernacularfiction – Chapter 1091 – I Know That We’re From Two Different Worlds things color share-p2 Brilliantfiction The Beautiful Wife Of The Whirlwind Marriage txt – Chapter 1134 – In That Case, Don’t Blame Me For Being Rude decision far recommendation-p1 Recent Comments A WordPress Commenter on Hello world! Archives September 2022 August 2022 July 2022 June 2022 May 2022 April 2022 Categories Uncategorized Meta Log in Entries feed Comments feed WordPress.org Proudly powered by WordPress | Theme: ioboot by ioTheme. | negative |
Who Has The Best Ira Roth Rates - Investing in Gold Skip to content Investing in Gold Home Privacy Policy Contact us Search this website Menu Close Home Privacy Policy Contact us Blog Home » Who Has The Best Ira Roth Rates Who Has The Best Ira Roth Rates Who Has The Best Ira Roth Rates Capitalists can purchase gold with exchange-traded funds (ETFs), buying stock in gold miners and also linked business, and also buying a physical product. These financiers have as several factors for investing in the steel as they do methods to make those financial investments. Who Has The Best Ira Roth Rates Some suggest that gold is a barbaric antique that no longer holds the financial top qualities of the past. In a contemporary financial environment, paper currency is the money of option. They compete that gold’s only benefit is the truth that it is a material that is utilized in jewelry. On the other end of the range are those that assert gold is an asset with numerous inherent high qualities that make it unique and also necessary for investors to keep in their profiles. >> Click Here to Learn More About Investing in Gold << A Quick Background of Gold In order to fully recognize the objective of gold, one need to recall to the beginning of the gold market. Gold’s background in society began well prior to also the old Egyptians, that started developing fashion jewelry and religious artefacts. Yet, it had not been till around 560 B.C. that gold began to work as a currency. During that time, sellers wished to develop a standardized and easily transferable type of money that would simplify profession. The production of a gold coin stamped with a seal seemed to be the solution, as gold precious jewelry was currently extensively accepted and also recognized throughout various corners of the earth. Complying with the advent of gold as money, its value continued to grow throughout Europe as well as the U.K., with antiques from the Greek and Roman realms prominently presented in galleries all over the world, as well as Great Britain developing its own metals-based money in 775. The British pound ( signifying a pound of sterling silver), shillings, and cent were all based on the quantity of gold (or silver) that it stood for.Eventually, gold signified wealth throughout Europe, Asia, Africa, and the Americas. Who Has The Best Ira Roth Rates The U.S. Bimetallic Criterion The united state government advanced with this gold tradition by developing a bimetallic standard in 1792. The bimetallic typical just stated that every monetary device in the united state had to be backed by either silver or gold. For instance, one U.S. dollar was the equivalent of 24.75 grains of gold. To put it simply, the coins that were made use of as money simply represented the gold (or silver) that was presently deposited at the financial institution. But this gold standard did not last permanently. During the 1900s, there were a number of vital events that eventually resulted in the transition of gold out of the monetary system. In 1913, the Federal Book was produced as well as begun releasing promissory notes (the contemporary version of our paper currency) that could be redeemed in gold on demand. The Gold Reserve Act of 1934 provided the united state federal government title to all the gold coins in circulation and placed an end to the minting of any kind of new gold coins. In other words, this act started developing the suggestion that gold or gold coins were no longer required in serving as money. The united state deserted the gold requirement in 1971 when its money ceased to be backed by gold. Gold in the Modern Economy Despite the fact that gold no more backs the U.S. dollar (or various other around the world currencies for that issue), it still brings importance in today’s culture. It is still vital to the global economic climate. To confirm this factor, there is no requirement to look further than the annual report of reserve banks and other economic companies, such as the International Monetary Fund. Currently, these companies are accountable for holding virtually one-fifth of the globe’s supply of above-ground gold. On top of that, a number of central banks have included in their existing gold books, mirroring worries about the lasting global economic climate. Who Has The Best Ira Roth Rates Gold Maintains Wide Range The factors for gold’s relevance in the modern-day economic situation center on the reality that it has actually effectively protected riches throughout thousands of generations. The very same, however, can not be claimed regarding paper-denominated currencies. To place points into viewpoint, take into consideration the following example: In the very early 1970s, one ounce of gold equated to $35. Allow’s state that back then, you had a option of either holding an ounce of gold or just maintaining the $35. They would both buy you the same points, like a brand-new company fit or a elegant bike. Nevertheless, if you had an ounce of gold today and transformed it for today’s costs, it would still suffice to get a all new suit, but the same can not be claimed for the $35. In short, you would have shed a substantial amount of your wealth if you chose to hold the $35 instead of the one ounce of gold since the value of gold has actually boosted, while the value of a dollar has actually been worn down by inflation. Who Has The Best Ira Roth Rates Gold As a Hedge Versus the Buck The suggestion that gold maintains wide range is even more vital in an financial environment where financiers are confronted with a decreasing united state dollar and also increasing inflation. Historically, gold has actually acted as a hedge against both of these circumstances. With increasing inflation, gold generally values. When financiers realize that their money is declining, they will certainly start placing their investments in a difficult property that has actually typically kept its worth. The 1970s offer a prime example of climbing gold prices in the midst of increasing inflation. The factor gold take advantage of a declining U.S. dollar is because gold is priced in U.S. dollars internationally. There are 2 reasons for this partnership. Initially, capitalists that are checking out purchasing gold (i.e., reserve banks) must sell their U.S. dollars to make this purchase. This eventually drives the united state buck reduced as international capitalists seek to expand out of the buck. The second reason relates to the truth that a weakening buck makes gold less costly for investors that hold other currencies. This leads to better demand from capitalists that hold money that have actually valued about the U.S. dollar. Who Has The Best Ira Roth Rates >> Click Here to Learn More About Investing in Gold << Gold as a Safe House Whether it is the stress in Eastern Europe, the Middle East, Africa, or in other places, it is coming to be increasingly noticeable that political and economic unpredictability is another reality of our modern financial environment. For this reason, investors generally check out gold as a safe house during times of political and also financial unpredictability. Background has plenty of breaking down empires, political successful strokes, and the collapse of currencies. During such times, capitalists who held gold had the ability to efficiently shield their wealth and, in some cases, also use the commodity to leave from all of the turmoil. Subsequently, whenever there are information events that mean some type of international economic uncertainty, capitalists will usually purchase gold as a safe haven. Gold as a Diversifying Investment As a whole, gold is viewed as a diversifying investment. It is clear that gold has historically functioned as an financial investment that can include a expanding element to your profile, no matter whether you are stressed over rising cost of living, a declining U.S. buck, or perhaps safeguarding your wide range. If your emphasis is merely diversification, gold is not correlated to supplies, bonds, as well as real estate. Who Has The Best Ira Roth Rates Gold as a Dividend-Paying Asset Gold supplies are generally more enticing to development investors than to earnings investors. Gold supplies usually fluctuate with the price of gold, yet there are well-managed mining business that pay also when the cost of gold is down. Boosts in the rate of gold are commonly magnified in gold-stock rates. A reasonably tiny boost in the cost of gold can lead to significant gains in the very best gold stocks and also proprietors of gold supplies usually get a much higher roi (ROI) than proprietors of physical gold. Even those capitalists focused mainly on development as opposed to consistent income can benefit from choosing gold supplies that show traditionally strong dividend efficiency. Supplies that pay dividends have a tendency to reveal higher gains when the market is rising as well as fare much better– generally, almost two times as well– than non-dividend-paying supplies when the total industry remains in a downturn. Who Has The Best Ira Roth Rates The Gold Mining Industry The mining sector, that includes firms that draw out gold, can experience high volatility. When evaluating the dividend performance of gold stocks, think about the business’s efficiency gradually in relation to dividends. Elements such as the company’s history of paying dividends and the sustainability of its dividend payout ratio are 2 crucial elements to check out in the business’s annual report and also various other financial declarations. A company’s capacity to maintain healthy returns payouts is substantially enhanced if it has regularly low financial debt degrees and also strong cash flows, and the historic fad of the business’s performance reveals continuously boosting financial obligation and cash flow figures. Given that any kind of firm undergoes growth and development cycles when it tackles even more financial debt and also has a lower cash money on hand balance, it’s crucial to examine its lasting figures rather than a shorter financial photo timeframe. Is There Ever a Hard Time to Purchase Gold? In order to determine the financial investment values of gold, let’s check its efficiency against that of the S&P 500 for the past year (as of March 2022). Gold has actually outshined contrasted to the S&P 500 over this duration, with the S&P index generating regarding 10.4% in total returns compared to gold, which returned 18.9% over the same duration. Who Has The Best Ira Roth Rates That stated, the period of time that we check out is incredibly essential. Considering longer or shorter durations will variously see gold or the broader market outperform, often by a wide margin. The point right here is that gold is not always a good investment. The most effective time to invest in almost any kind of property is when there is unfavorable belief and also the property is cost-effective, offering considerable upside prospective when it goes back to prefer, as indicated above. There are both benefits and also disadvantages to every investment. If you think gold could be a sure thing against rising cost of living, purchasing coins, bullion, or precious jewelry are courses that you can take to gold-based success. >> Click Here to Learn More About Investing in Gold << You Might Also Like Ira Silver Attorney Gold In Ira Account Noble Gold Ohio Copyright - OceanWP Theme by OceanWP | negative |
Detroit police search for individuals in connection with nightclub shooting on city’s west side 60º Join Insider Sign In Search News Watch Live Local News Traffic National World Entertainment Health Politics Elections Decision 2022 Community Trust Index Local 4+ Watch Local 4+ Live in the D Help Me Hank Investigations Flashpoint Jason Carr Live Money Minute Tasty Tuesday Fitness Friday Solutionaries Something Good TV Listings MeTV Detroit Weather Weather Center Weather News Alerts StormPins School Closings Forecasting Change 4ZONE - Metro 4ZONE - North 4ZONE - South 4ZONE - West Sports Sports Odds Lions Lions Stats Tigers Tigers Stats Red Wings Red Wings Stats Pistons Pistons Stats Wolverines Spartans 4Frenzy Features Watch Local 4+ Vote 4 The Best Click On Deals Jobs 4 You 4YI All 4 Pets Tech Time Travel Hispanic Heritage Month Mental Health Matters Brag Book Sunshine Awards In The D Food Contests Live In The D Dine In The D Click On Deals What's The Buzz Uniquely Detroit Events Live Guide Ann Arbor Headlines Topics Sports Events Ann Arbor Weather Get Involved Newsletters Contact Us Meet The Team Careers at WDIV Advertise with us News Local 4+ Weather Sports Features Live In The D Ann Arbor Newsletters Contact Us News Local 4+ Weather Sports Features Live In The D Ann Arbor Newsletters Contact Us Local News Grant Hermes, Anchor/Reporter DeJanay Booth, Web Producer Published: September 28, 2020, 7:02 PM Updated: September 28, 2020, 7:26 PM Tags: Detroit, Michigan, Wayne County, Local News, Shooting, Nightclub Shooting, Nightclub, Michigan Avenue, Detroit Police Department, DPD, DPD Fourth Precinct Investigative Unit, Sting Gentlemen's Club, Detroit's West Side, Local, News, Crime, Detroit Crime, Detroit Crime News, Local Crime Sign up for our Newsletters LATEST NEWS 1 hour ago Local churches hope to bridge the digital divide in Detroit 1 hour ago University of Michigan’s marching band celebrates 125 years of tradition 1 hour ago Morning 4: WWJ news anchor murdered in Macomb County -- and more news 4 hours ago Popular Detroit restaurant makes New York Times ‘best’ list CLICK ON DEALS Get your Aidan Hutchinson Detroit Lions jersey! Local News Detroit police search for individuals in connection with nightclub shooting on city’s west side 6 people were injured in shooting early Monday morning Grant Hermes, Anchor/Reporter DeJanay Booth, Web Producer Published: September 28, 2020, 7:02 PM Updated: September 28, 2020, 7:26 PM Tags: Detroit, Michigan, Wayne County, Local News, Shooting, Nightclub Shooting, Nightclub, Michigan Avenue, Detroit Police Department, DPD, DPD Fourth Precinct Investigative Unit, Sting Gentlemen's Club, Detroit's West Side, Local, News, Crime, Detroit Crime, Detroit Crime News, Local Crime Six people shot outside of Detroit strip club DETROIT – Detroit police are seeking the public’s help in identifying individuals in connection with a non-fatal shooting early Monday morning outside a nightclub on the city’s west side. According to police, the shooting happened at about 1:45 a.m. after a show ended at the Sting Gentlemen’s Club on Michigan Avenue. Six people were injured in the shooting. Police said all six victims -- four men and two women -- are in their 20s. Two of the men are in critical condition. The other victims are listed in stable condition. Read: 6 people shot outside club on Detroit’s west side The suspected shooter, or shooters, drove away in a silver pick up. Police are searching for a newer model silver Dodge Ram truck, which was seen leaving the area after the shooting. Video from a nearby business showed two men on the sidewalk with a group following behind them. As they were walking to their car, there was commotion and the men ducked. One of the men draws a gun but doesn’t fire before the group runs for cover. The two men started firing shots from behind their SUV before running across the street. Their SUV drives away without them. “At this point, we’re unsure exactly what the motive was in this shooting, and we’re working with the detectives to determine that at this point,” said Detroit police Cmdr. Kari Sloan. The shooting is Detroit’s eighth mass shooting of the year. Police said they’ve had trouble with nightclubs before. “We do have issues with the adult entertainment clubs in that are and we are continually working to enforce in that area. But it is something that’s on our radar and something we’re attempting to keep at bay,” Sloan said. Anyone with information is asked to contact Detroit’s Police Department’s Fourth Precinct’s Investigative Unit at 313-596-5440 or Crime Stoppers at 800-Speak Up. More: Detroit crime news Detroit police are investigating a shooting near a strip club on the city's west side early Monday, Sept. 28, 2020. Photo provided by Detroit Police Department. (WDIV) Copyright 2020 by WDIV ClickOnDetroit - All rights reserved. About the Authors: Grant Hermes Grant comes to Local 4 from Oklahoma City. He joins the news team as co-anchor of Local 4 News Today weekend mornings and is a general assignment reporter. email facebook twitter instagram DeJanay Booth DeJanay Booth joined WDIV as a web producer in July 2020. She previously worked as a news reporter in New Mexico before moving back to Michigan. email TV Listings Contests and Rules Email Newsletters RSS Feeds Closed Captioning / Audio Description Contact Us Careers at WDIV Terms of Use Privacy Policy Public File FCC Applications Do Not Sell My Info Follow Us facebook twitter instagram snapchat rss Get Results with Omne If you need help with the Public File, call (313) 222-0566. Copyright © 2022 ClickOnDetroit.com is managed by Graham Digital and published by Graham Media Group, a division of Graham Holdings. | negative |
Emperor : the gates of Rome - Kenton County Catalog My Account New Items Hoopla Overdrive Events Ask a Question Record Details Catalog Search Search the Catalog Advanced Search Browse the Catalog -- Basket Actions -- View Basket Place Holds Print Title Details Email Title Details Add Basket to Saved List Clear Basket 0 records in basket Search: Type: Keyword Title Journal Title Author Subject Series Digital Bookplate Format: All Formats All Books All Music All Videos All Videos Blu-ray Braille CD Audiobook CD Music recording DVD E-audio E-book E-video Equipment, games, toys Kit Large Print Book Map Microform Music Score Picture Preloaded Audio Serials and magazines Software and video games Library: Kenton County Kenton County Public Library Administration Covington Branch Empower Tools Erlanger Branch Homebound Wm. E. Durr Branch School Outreach School Outreach Program Video Games Playstation 3 & 4 & 5 Adult Books Nintendo Games XBox Games Adult DVD Adult DVD and Blu-ray Adult Fiction Adult Nonfiction Adult Foreign Language Kentucky Bluegrass Award Winners Quick Pick Nonfiction Empower Tools Library of Things Book Discussion Kit Young Adult Books Graphic Novels Children's DVDs Children's Fiction Children's Nonfiction Children's Easy Children's Easy Readers Children's Foreign Language Children's Video Games Blu-ray Local Authors Young Adult Materials Children's Books Children's Books with Audio Toddler Music CDs Local Music Collection Audios Playaways Large Type Magazines New Materials All Libraries Emperor : the gates of Rome / Conn Iggulden. Iggulden, Conn.(Author). Book Place Hold Add to basket Remove from basket Print / Email Permalink Disable Highlighting Available copies 1 of 1 copy available at Kenton County. Current holds 0 current holds with 1 total copy. View other formats and editions Book (4) English (4) View all formats and editions (4) Show Only Available Copies Location Call Number / Copy Notes Barcode Shelving Location Status Due Date Erlanger Branch IGGUL C (Text) 33126009921911 Adult Fiction Available - Record details ISBN: 0385336608 Physical Description: 357 p. ; 24 cm. Publisher: New York : Delacorte Press, 2003. Content descriptions General Note: Originally published in 2002 under title: Emperador, las puertas de Roma. Search for related items by subject Subject: Caesar, Julius > Fiction. Marius, Gaius, (approximately) 157-86 B.C. > Fiction. Sulla, Lucius Cornelius > Fiction. Heads of state > Fiction. Generals > Fiction. Genre: Biographical fiction. Historical fiction. Search for related items by series Emperor series ; v. 1 ► ▼ Google Preview ► Awards, Reviews, & Suggested Reads ► Summaries & More ► Additional Content ► Shelf Browser ► MARC Record Additional Resources Get a Card | Loan Periods | Research & Homework | History & Genealogy | Interlibrary Loan | Request a Purchase | Copyright © 2006-2022 Georgia Public Library Service, and others Powered by | negative |
Rene Herbst Highback Cord Sandows Armchair | B2H Browse Close menu Search modern classic contemporary shop by type See More "Close Cart" chairs tables sofas accessories by room by designer Clearance Sale Best Sellers Shopping Cart "Close Cart" Close By placing and confirming your order, you agree to these terms and conditions. Your Account Sales Tax Lead Time Warranties Cancellation Policy Receipt of Goods Damage Return Policy Receipt of Glass and Marble Satisfaction Guarantee / Refund Policy Shipping and Handling Storage User Warranties Disclaimer of Warranties Indemnification Termination International Customers Your Account You are responsible for maintaining the confidentiality of your account and password and for restricting access to your computer, and you agree to accept responsibility for all activities that occur under your account or password. If you are under 18, you may use bauhaus2yourhouse.com only with involvement of a parent or guardian. Bauhaus2yourhouse.com reserves the right to refuse service, terminate accounts, remove or edit content, or cancel orders at their sole discretion. Sales Tax Bauhaus2yourhouse.com is charges no sales tax on any orders shipped within the United States, except California. You are expected to comply with your state's current laws regarding purchases over the Internet. Lead Time Ready to Ship products are shipped within 7 business days of acknowledgment of order from Bauhaus 2 Your House Customer Service. Factory Direct orders are custom orders built specifically for our customers by our factory. Lead time for Factory Direct orders is typically 10-12 weeks. While Bauhaus 2 Your House makes every effort to meet these lead times, they are not guaranteed. Bauhaus 2 Your House is not responsible for delays in shipments due to circumstances beyond our control, such as acts of God, international port delays and closures, terrorism, or other customs, freight, or shipping delays. Every effort is made to meet our estimated shipping dates, but failure to do so does not justify their cancellation. Warranties Bauhaus 2 Your House reserves the right, at its sole discretion to change, modify, add or remove any portion of these terms and conditions of use, in whole, or in part at any time. Designs, materials, construction, production technology and specifications are subject to change without notice. Bauhaus 2 Your House reserves the right to modify and/or improve all products that we offer for sale. Bauhaus 2 Your House warrants its products to be free from defects in material or workmanship, given normal use and care, for a period of 1 Year from the date as indicated on the invoice, subject to the limitations set forth: During this warranty period, Bauhaus 2 Your House will, at its option, repair or replace, free of charge to the original owner, any part or assembly found to be defective. This warranty is not transferable and terminates when a third party becomes entitled to use the product during the warranty period. Claims must be in writing. All claims must include the name, address, and telephone number of the purchase, unit model number, general description of the product, description of the defect(s), photographs, and documentation supporting the date of initial delivery. Bauhaus 2 Your House will contact the customer to arrange for the repair or replacement of the defective product covered by this warranty at Bauhaus 2 Your House's expense. This warranty does not apply to damage resulting from accidents, alterations to the product other than by Bauhaus 2 Your House or an authorized person, installation by other than a Bauhaus 2 Your House or an authorized person, or the product not being used in accordance with Bauhaus 2 Your House's installation and/or application guidelines. Upon the occurrence of any one or more of these events, this warranty becomes void. Because of the natural variation over which Bauhaus 2 Your House has no control, the warranty does not extend to color, grain, texture of wood, plastic, marble, or fabric. Bauhaus 2 Your House does not warrant the matching of color, grain or texture and shall not be liable for consequential or incidental damages. The images on this website represent an approximate rendering of the item requested and is not a representation of warranty regarding the final product. Please note: the colors displayed on your screen may differ from the actual colors. No rights can be derived from this. Cancellation Policy Orders not canceled within 24 hours of acknowledgment from Customer Service will be subject to a 25% - 50% cancellation fee in addition to any shipping charges incurred. A cancellation will not be accepted without our approval, on any order, once it is in production. Cancellations will not be accepted without our approval on any Factory Direct orders once they are in production. Factory Direct purchases are ordered with every effort exerted to meet our estimated shipping dates, but failure to do so does not justify their cancellation. Factory Direct -- products made to order -- are not returnable.All canceled orders will be subject to a minimum 10% charge. Receipt of Goods YOU ARE RESPONSIBLE FOR RECEIVING YOUR GOODS IN A TIMELY MANNER. The goods shall become the property of the Purchaser at the time It arrives at your front door. If delivery is prevented by difficult access, incorrect Information, or if the Purchaser wrongfully fails to arrange to receive the delivery as per the arrangements with the Delivery Service, the Purchaser is still responsible for the goods. ANY DAMAGE OR COSTS INCURRED FOLLOWING DELIVERY OR ATTEMPTED DELIVERY SHALL BE THE RESPONSIBILITY OF THE PURCHASER. FAILURE TO ACKNOWLEDGE OR RECEIVE GOODS IN A TIMELY MANNER IS NOT THE RESPONSIBILITY OF BAUHAUS TO YOUR HOUSE. You will be issued an email at the time of shipping from the delivery service with tracking information; we are not responsible for filtered content. Items returned to the Bauhaus 2 Your House warehouse after repeated attempted delivery (services make at least three delivery attempts and leave notice) are the property of the purchaser, and will be re-shipped at the purchaser's expense. Damaged product will not be repaired or replaced unless the shipping error is determined to be the fault of Bauhaus 2 Your House (i.e. order shipped to wrong state). An order canceled at this point will be assessed a 50% restocking fee plus the cost of the original delivery. Damage Return Policy Claims for defective or damaged items must be filed with us within 3 days of delivery, in writing, with images. Please inspect your items immediately upon delivery. All shipments are picked up by the transportation company and signed for in good condition. (Bauhaus 2 Your House's liability ceases at that time). When you receive product from our freight carriers, it is extremely important to inspect the carton/crate for any damage or even an indication of the possibility of damage before signing any documentation. You will be asked to sign a delivery receipt, which is essentially a legal contract that indicates you are receiving the product in perfect condition. All delivery receipts contain a box to note any "visible" damage on the carton/crate. This is your insurance that you will have the ability to be awarded the freight claim; without notation of damage (or the indication thereof) there is no recourse. If damage is noted, you must keep product in original shipping box or container for inspection by carrier. Enter a claim with the transportation company. If you have any questions regarding this policy or the process involved, please feel free to contact us directly at (888) 272-5331 or email Customer Service. Receiving Glass and Marble While our glass and marble pieces are shipped using industry standards and best practices, they are vulnerable materials, and even under the best conditions, damages sometimes occur. IT IS THEREFORE CRITICAL THAT YOU BE AWARE AND ADVISED OF HOW TO RECEIVE THESE PIECES. Damage to glass and marble pieces MUST be noted at the time of delivery. These items arrive crated, you will need to carefully inspect them while they are intact, or de-crate them for proper inspection. FAILURE TO INSPECT ITEMS AT TIME OF DELIVERY, OR SIGNING FOR DAMAGED PRODUCT "IN GOOD CONDITION" MAY MAKE YOUR DAMAGE CLAIM OR CREDIT CARD REBUTTLE IMPOSSIBLE. Satisfaction Guarantee / Refund Policy Bauhaus 2 Your House proudly stands behind our designer reproductions by offering our customers our Satisfaction Guarantee Policy. If any Bauhaus 2 Your House customer is not fully satisfied with any of our products, simply contact is in writing for authorization and return the product to our warehouse within 10 business days from delivery. Refunds for Ready 2 Ship (In-stock) products will be issued store credit or exchange only less the 30% Restocking Fee, shipping, and a $25 re-packaging charge, if merchandise is returned at buyers expense in its original condition and in original packaging within 10 days. Credits (other than store credits) will be refunded via check. Factory Direct (non-stock items or custom orders) are not returnable. Returns must be pre-authorized by calling (888) 272-5331. Actual cost of shipping item to you will not be credited or refunded. Store credit is valid for one year from date of issue. Thereafter, unused credit is forfeited. Claims must be in writing. Claims for defective or damaged items must be filed within 3 days of delivery. Please inspect your items immediately upon delivery. Claims received after 3 days of delivery will not and cannot be processed. Please be aware that fine furniture is highly susceptible to damage during transit. We take great care to pack shipments so that they will arrive safely, so be sure to retain the original packing materials, original receipt and all merchandise tags for any item that you wish to return to us. You may have to provide supplementary packing materials if the outer carton has been worn during the original trip out to you. Upon arrival of returned goods at the warehouses items will be examined for merchantability. In the event that goods are deemed to have been damaged by the customer, the customer may be charged up to the full price of the item(s). A $25 repackaging fee may also be assessed if packaging is unusable. (Shipping is not refundable.) IMPORTANT: CUSTOMER MUST RETURN ALL PRODUCTS IN THE EXACT CONDITION, AND IN THE EXACT PACKING MATERIALS IT WAS RECEIVED IN AT THE CUSTOMERS EXPENSE IN ORDER TO BE ELIGIBLE FOR REFUND. BAUHAUS 2 YOUR HOUSE RESERVES THE RIGHT TO REFUSE OR REJECT ANY RETURN THAT DOES NOT MEET THE CONDITIONS DESCRIBED ABOVE. Schedule the shipment with the same carrier used for delivery (shipper's information is included with every order), prepay and insure your package(s) and return them to: Bauhaus 2 Your House Attention: RETURNS C/O Justo Delivery Warehouse 3300 Keller St. #101 Santa Clara, CA 95054 SHIPPING AND HANDLING Free Shipping: Free Shipping is only available within the Contiguous United States! For all orders going to destinations outside the Contiguous United States (including Alaska & Hawaii ), or international destinations (Mexico, Canada, EU), please call Bauhaus 2 Your House Customer Service at (888) 272-5331 or email Customer Service to determine your shipping cost. Bauhaus2YourHouse.com will attempt to ship all merchandise within five business days of purchase unless otherwise specified. Delivery estimates are good faith estimates only. Bauhaus2YourHouse.com will not be liable for any loss, damage, cost or expense related to any delay in shipment or delivery. Residential Curbside Delivery: Unless otherwise specified, Bauhaus 2 Your House will quote all product shipment for residential [curbside only] delivery to you when possible. If necessary, when residential is unavailable, Dock-to-Dock delivery can be set up in which the product is delivered to loading bays designed for trailers to back up level to warehouse floor, which requires no special equipment to load/unload. Bauhaus 2 Your House will pass on all information on the location and the local contact to the buyer when we acknowledge your order. Buyer will need to make all local arrangements for pick up of their products. IT IS YOUR RESPONSIBILITY TO ARRANGE TO MEET THE SHIPPER AT THE DELIVERY ADDRESS AT THE APPROPRIATE TIME. PLEASE NOTE YOU WILL NOT RECEIVE A CALL FROM THE SHIPPER ADVISING OR REMINDING YOU OF THE DELIVERY TIME. IT IS YOUR RESPONSIBILITY TO TRACK THE SHIPMENT USING THE TRACKING NUMBERS THAT WE PROVIDE TO YOU. Additional Delivery Options: Bauhaus 2 Your House is happy to work with customer's specific needs for delivery and can accommodate White Glove service (where available) and Inside Delivery at an additional charge. Please call Bauhaus 2 Your House Customer Service at (888) 272-5331 or email Customer Service to determine your additional shipping charges. White Glove/Inside Delivery: Furniture is big, apartments can be small. We note the dimensions of our product on the website and on your confirmation. We are not responsible for items that do not fit into your home. If items do not fit, they will be delivered curbside or "first dry area." Storage Items may be stored, with a request by the customer in writing, for 15 days after receipt in our warehouse. After two weeks, there is a storage fee of $25 per item, per month (assessed on the first of the month). Items unclaimed after 90 days become the property of Bauhaus 2 Your House, and customer forfeits any payment(s) made. Changes to Terms and Conditions and To Site Bauhaus 2 Your House reserves the right to modify or change the terms of use of this site with or without notification. User Warranties In placing an order, you warrant that you are over 18 years of age, and that you are providing accurate, true, and complete information, and that you have the authority to place the order. Disclaimer of Warranties You expressly understand and agree that your use of this site is at your sole risk and that this site is provided on an "as is" and "as available" basis. Bauhaus 2 Your House.com makes no representations or warranties of any kind, express or implied, as to the operation of this site or the information, content, materials or products included on this site. In the event that the delivery company is prevented from carrying out Its obligations as a result of any cause beyond its control such as but not limited to Acts of God, War, Strikes, lock-outs, Flood and Failure of third parties to deliver goods, Bauhaus 2 Your House and the delivery company shall be relieved of its obligations and liabilities for as long as such fulfillment is prevented. Bauhaus2YourHouse is at no time providing any warranty or any type of guarantee that any particular item/model of product or accessory is suitable or usable for any particular purpose, whether general or specific, whatsoever. Indemnification You agree to indemnify and hold harmless Bauhaus 2 Your House.com and its officers, directors, employees and suppliers, from any claim, demand, action or damage, including reasonable attorneys' fees, made or incurred by any third party arising out of or related to your use of this site. Termination Bauhaus 2 Your House reserves the right to terminate your account and restrict your use of this site if we have reason to believe you have violated any of these terms and conditions, including providing us with false information. International Customers This Site is controlled, operated and administered by Bauhaus 2 Your House from its offices within the United States of America. Bauhaus 2 Your House makes no representation that materials on the Site are appropriate or available for use at other locations outside of the United States and access to them from territories where their contents are illegal is prohibited. You may not use the Site or export the Content in violation of U. S. export laws and regulations. If you access this Site from a location outside of the United States, you are responsible for compliance with all local laws. 1-888-272-5331 | Track Order Cart (0 items $0.00) Search Search Home Modern Classic Chairs Modern Classic Accent Chairs Bentwood Chairs Cantilever Chairs Dining Chairs Lounge Chairs Sofas Benches Chaises Ottomans Stools Task Chairs Office Chairs Outdoor Chairs Stacking Chairs Rocking Chairs Tables Modern Classic Side Tables Coffee Tables Convertible Tables Extension Tables Occasional Tables Dining Tables Outdoor Tables Sofas Modern Classic Two Seat Three Seat Benches Storage Coat Racks Shelving & Bookcases Sideboards & Credenzas Accessories/Accents Lighting Table Lamps Floor Lamps Space Saving Furniture Contemporary Chairs Accent Chairs Bentwood Chairs Cantilever Chairs Dining Chairs Lounge Chairs Sofas Benches Chaises Ottomans Stools Task Chairs Office Chairs Outdoor Chairs Stacking Chairs Rocking Chairs Tables Side Tables Coffee Tables Convertible Tables Extension Tables Occasional Tables Dining Tables Outdoor Tables Sofas Two Seat Three Seat Space Saving Furniture Benches Storage Coat Racks Shelving & Bookcases Sideboards & Credenzas Accessories/Accents Desks By Type Chairs Modern Classic Accent Chairs Bentwood Chairs Cantilever Chairs Dining Chairs Lounge Chairs Sofas Benches Chaises Ottomans Stools Task Chairs Office Chairs Outdoor Chairs Stacking Chairs Rocking Chairs Tables Modern Classic Side Tables Coffee Tables Convertible Tables Extension Tables Occasional Tables Dining Tables Outdoor Tables Sofas Modern Classic Two Seat Three Seat Space Saving Furniture Benches Storage Coat Racks Shelving & Bookcases Sideboards & Credenzas Accessories/Accents Lighting Modern Classic Table Lamps Desks By Designer A-H Alvar Aalto Anonymous Carl Aubock Mario Bellini Oliver Percy Bernard Harry Bertoia Otto Blumel Marianne Brandt Erich Brendel Marcel Breuer Eduard Buquet Pierre Chareau Donald Deskey Paolo Favaretto Mariano Fortuny Jean Michel Frank Paul Theodore Frankl Eileen Gray Walter Gropius Geoffrey Harcourt Rene Herbst Josef Hoffmann Wolfgang Hoffmann I-N Max Ingrand Arne Jacobsen Folke Jansson Carl Jucker Peter Keler Frederick Kiesler Florence Knoll Le Chevalier Le Corbusier Jules Leleu Angelo Lelli Arik Levy Kho Liang le El Lissitzky W. & H. Luckhardt Charles Rennie Mackintosh Gabriele Mucchi George Nelson Patrick Norguet O-Z Verner Panton Gyula Pap Pierre Paulin Lilly Reich Gerrit Rietveld Eero Saarinen The Shakers Alison Smithson Mart Stam Philippe Starck Gerald Summers Designs by Michael Thonet Michiel van der Kley Mies van der Rohe Martin Visser Wilhelm Wagenfeld V.G. Weite Stefan Wewerka By Brand Artifort BBB Bross Casprini Driade Giovannetti GTV ITF Lapalma Luxy Mast Elements Matrix International Midj Softline Spectrum Tecnolumen Tecta Ton Tonon Clearance Sale Best Sellers Cart Home › Rene Herbst Highback Cord Sandows Chair The Rene Herbst Highback Cord Sandows Chair is just one example of the pioneering use of industrial material for which Rene Herbst was famous. His development of this Highback Cord Chair was themed by the continuity of form that utilized elastic cords that at that time were used to wrap parcels. It was first released to the public at the Paris Salon d'Automne des Artistes Litterateurs in 1929. Rene Herbst founded the company Etablissements Rene Herbst in an effort to produce and sell his projects. Made in Italy. Dimensions: H 37 1/2" x D 19" x W 20 3/4" Materials: Armchair in chrome-plated tubular steel. Seat, back, and arms in colored elastic cords. Share | Rene Herbst Highback Cord Sandows Chair 1 - $1,138.00 USD Regular price Quantity $1,138.00 NO SALES TAX FREE SHIPPING ON U.S. ORDERS Customize Add to Cart Select your customizations below. Once complete you can add it to your cart. Frame Your Selection The Rene Herbst Highback Cord Sandows Chair is just one example of the pioneering use of industrial material for which Rene Herbst was famous. His development of this Highback Cord Chair was themed by the continuity of form that utilized elastic cords that at that time were used to wrap parcels. It was first released to the public at the Paris Salon d'Automne des Artistes Litterateurs in 1929. Rene Herbst founded the company Etablissements Rene Herbst in an effort to produce and sell his projects. Made in Italy. Dimensions: H 37 1/2" x D 19" x W 20 3/4" Materials: Armchair in chrome-plated tubular steel. Seat, back, and arms in colored elastic cords. - Get Connected modern classic contemporary shop by type by room by designer Clearance Sale Best Sellers Search About Us Testimonials FAQs Privacy Policy Terms & Conditions Track Order Contact ABOUT TRUST ONLINE © 2019 Bauhaus 2 Your House. All rights reserved. 1-888-272-5331. Bauhaus 2 Your House is UpFront Accepted Payments american express master visa {{name}} {{#properties}} {{#each this}} {{#if this}} {{@key}}: {{this}} {{/if}} {{/each}} {{/properties}} − Reduce item quantity by one + Increase item quantity by one {{#if discountsApplied}} {{{originalLinePrice}}} {{{linePrice}}} {{else}} {{{linePrice}}} {{/if}} {{#if discountsApplied}} {{#each discounts}} {{ this.title }} {{/each}} {{/if}} {{/items}} Special instructions for seller {{ note }} Subtotal {{{totalPrice}}} {{#if totalCartDiscount}} {{{totalCartDiscount}}} {{/if}} I agree with the Terms and Conditions. Please agree to the Terms and Conditions Check Out → − Reduce item quantity by one + Increase item quantity by one − Reduce item quantity by one + Increase item quantity by one - giveaway: and freebie-not-in-cart: | negative |
Get the biggest daily stories by email Subscribe Thank you for subscribing We have more newsletters Show me See our privacy notice Could not subscribe, try again later Invalid Email
A woman who cried rape has been handed a fixed penalty notice for wasting police time.
She had claimed two men had grabbed her and dragged into a house in Moss Side in broad daylight before being sexually attacked.
It prompted a huge police investigation and patrols were increased in the area.
But police have now confirmed the incident she described at a house on Adscombe Street on May 14 last year never happened.
The three men who were arrested on suspicion of rape have now been released without charge.
And the woman who had made the allegation has been handed a fixed penalty notice for wasting police time.
Detective Inspector Neil Charnock, of Greater Manchester Police's Serious Sexual Offences Unit, said: "On this occasion our investigation has proven the rape... to be a false account.
"This would have naturally been a worrying incident for the community therefore I hope it reassures them to know that the report of rape which was made to the police in fact did not happen.
"A substantial amount of time went into investigating the incident which resulted in three arrests. This would have been an extremely stressful and upsetting time for these men who have now been released without charge. The woman who made the false report has subsequently been issued with a fixed penalty notice for wasting police time.
"This incident does not change the fact that we take all reports of rape seriously and investigate thoroughly and without prejudice, which can be demonstrated by our significant investment in relation to this report.
"Incidents such as this not only detract our resources away from genuine reports that need our valuable time, but can have devastating consequences for anyone who has been wrongly accused.
"Greater Manchester Police encourages anyone who has been a victim of rape or any sort of sexual abuse to come forward, but I must also stress the importance of providing police with genuine reports due to the time we devote to investigating these cases.
"I hope this does not deter victims from coming forward to police. We have specially-trained officers who give a tremendous amount of time and support to anyone who has been a victim of rape and we work closely with the St Mary's Sexual Assault Referral Centre. We can not only help you, but also put your attacker behind bars."
More news from the Manchester Evening News
Find out what's happening where you live with our In Your Area section
Read the Manchester Evening News on your phone - download the Apple MEN App here and the Android MEN App here - and get the paper as an e-edition every morning by subscribing here | positive |
A woman's seven-year obsession with her former boyfriend made him feel like he was only safe when she was in prison, a court has recounted.
The man has moved on to another relationship and he and his partner have spent about $38,000 including on lawyer's fees, repairing property damage and installing home security systems.
The woman, Kerryn Mitchell, 45, has today lost an appeal against a sentence of two years and one month's jail imposed in Wellington District Court in September.
On the morning her trial was to have begun she pleaded guilty to charges of intentional damage and breaching a domestic protection order.
The following month Mitchell was back in court on civil cases relating to her time in custody.
While in prison earlier this year Mitchell had destroyed four mattresses she said were not fit for the purpose. A judge has struck out her civil claim alleging that leaving her without a mattress for six days had denied her the minimum entitlement for a prisoner.
But in future she can pursue a claim for damages over the purported reasons prison authorities withheld her copy of The Dominion Post and letters she had written to another prisoner.
In the Court of Appeal decision issued today the three judges said Mitchell had gone on a rampage with a tyre iron at a former boyfriend's house in December last year.
Mitchell left abusive messages on his phone blaming him for a protection order that had been in force against her for five years.
At about 11.30pm that night she went to his house with a tyre iron and smashed most of the windows she could reach, two outside lights, and broke a glass door pane to get into the house.
A friend of the victim told Mitchell that the victim was not home so she left, smashing the letter box with the tyre iron as she went.
"She proceeded to sit down, drop the tyre iron and waited for the police to arrive," the Court of Appeal judges said in their decision.
Mitchell was sentenced at Wellington District Court in September to the jail term. She was also ordered to pay $2863.41 reparation for the damage but today the judges said there was nothing to indicate that the reparation would be paid.
The Court of Appeal said Mitchell's relationship with the victim ended in about 2005 and in April 2008 a protection order was obtained against her.
The order, which was later extended to cover the victim's new partner, has been breached nine times.
The December window smashing was the latest evocation of Mitchell's "seven-year obsession with the victims" which was unusual and concerning, the court said.
"Ms Mitchell's conduct over the five and a half years in which the protection order has been in place has been extraordinary," it said.
In his statement for the District Court sentencing the victim had said he only feels physically safe when Mitchell was in custody. His partner keeps the doors locked all the time.
Mitchell's previous convictions include 38 for assault of various kinds, two for injuring with intent to injure, and nine of wilful damage, as well as threatening to kill.
"Even excluding her offending against these victims, it is a record of violence and defiance of authority," the Court of Appeal said.
The court said her "most unfortunate personal circumstances" had been recognised many times by sentencing judges but she continued to offend. | positive |
ConsenSys has added a new decentralized application (Dapp) to its Ethereum blockchain-as-a-service toolkit available on Microsoft’s cloud computing platform Azure.
Called the Ethereum Total Return Swap (eTRS), the application aims to serve as both a functional and an example use case that will allow internal tech teams at Microsoft Azure clients to better understand and utilize the toolkit, first announced in October.
Marley Gray, Microsoft’s director of technology strategy for financial services explained that the offering part of the tech giant’s ongoing partnership with ConsenSys, noting that eTRS aims to “demonstrate the power” of the Ethereum blockchain through a step-by-step guide for how a swap agreement can be facilitated on the platform.
Gray told CoinDesk:
”This solution allows our customers to stand up a complex reference implementation on the blockchain that can fundamentally change how the swaps market functions. […] The ability to rapidly develop and express existing financial products using this platform can help ignite innovation in the industry.
Gray said that eTRS will allow clients to create swap agreements as well as monitor the risk valuations, funding and pricing of the swap in real time. The offering was previewed as part of Microsoft Connect 2015, a conference held from 18th to 19th November in New York.
In statements, ConsenSys said that the offering will illustrate how the Ethereum blockchain can complement bitcoin by expanding the capabilities of blockchains beyond value transfer to “next-generation applications”.
Founded in 2014, ConsenSys describes itself as a distributed Dapp “production studio” focused on offering a developer sandbox for the Ethereum network that enables those using its tools to build without working with the core protocol.
The startup, which claims 60 members worldwide, also works to create second-level applications built on Ethereum that showcase how it can be leveraged for use cases such as peer-to-peer lending, identity and reputation, while also serving as separate products as part of its “hub-and-spoke model”.
About eTRS
On the surfact, ConsenSys’s take on total return swaps functions similarly to existing agreements, wherein one party makes payments to another based on the return of a reference asset.
Unique to the cryptoswap offering, however, is that ConsenSys uses elements of the Ethereum blockchain that allow for referencing client accounts, technology it says will help fulfill know-your-customer (KYC) and anti-money laundering (AML) requirements digitally.
ConsenSys CFO of enterprise capital markets James Slazas suggested the release will help highlight the potential cost savings Microsoft’s clients could capture by building similar applications with its toolkit, which is based on its work building identity tools into the Ethereum blockchain itself.
“It’s not just to use but to get their minds thinking about, if I had a global system for decentralized identity, that means I don’t have the cost of onboarding new clients, so I can change the level of client we take on, because the cost reduction occurs,” Slazas said.
In eTRS, Ethereum is then used to automate collateral requirements based on the price of the assets used. The creditworthiness of those involved in the transaction will, in turn, be updated on a reputation system that is adjusted based on performance.
“Finally, we will reconcile the counterparties accounting records with triple-entry accounting on Ethereum, whereby the third journal entry is recorded on an immutable blockchain drastically reducing the possibility of fraud,” the company explained.
Similar to a number of startups seeking to use blockchains to lower transaction settlement times, ConsenSys said its “cryptoswaps” have t+0 settlement, completing days faster than the industry standard t+3.
Live demonstration
Slazas explained that the eTRS was launched in conjunction with the Microsoft Connect conference so that the ConsenSys team could make its offering more “relatable” to potential enterprise users.
“We highlighted each of the areas that the blockchain is having impact. The eTRS isn’t just you and I call each other and agree to some terms to get [a swap] settled,” he explained.
He went on to describe how he introduced eTRS as a project designed to work with bank customers and that had gone through KYC processing.
“We are able to use that reputation and identity to enter into the transaction. That makes trading much more streamlined and it has an impact on banks,” he continued, adding:
“It wasn’t ‘Hey we’re trying to sell the Dapps to these banks.’ It was more to be able to show them what could be done.”
Slazas said that as many as 50 individuals attended the live demonstration.
Image credit: hans engbers / Shutterstock.com | positive |
lready stated, this password is HDJ7D-HF54D-8DN7D and is the same for everyone affected by this program.
Though EduCrypt provides a link to a Hidden Tear decryptor, I suggest users use the one created by Michael Gillespie as we know that it is trustworthy. This decryptor can be downloaded at the following URL: https://download.bleepingcomputer.com/demonslay335/hidden-tear-decrypter.zip.
Though I do not agree with the methods the developer used to try and teach victim's a lesson about being safe on the Internet, his statements are correct. Users need to be very careful these days about what they download and run from the Internet. Malware is running rampant and users need to be extra vigilant or the consequences can be costly. | positive |
MHGen database is out! Follow @kiranico_en for updates!
A database for Monster Hunter 4 Ultimate. Acknowledgements: I compiled data from 6 sources to make sure things are as complete and correct as they can be. These include the MH4G game, Official MH4G Guidebook, http://wiki.mh4g.org/, http://www61.atwiki.jp/3dsmh4g/pages/1.html and http://mh4info.com/ for data. I also used Ping's Dex https://sites.google.com/site/pingsdex/pingsmh4gdex for comparison, error correction, missing data and quest names.
I was able to receive help from the following people on /r/MonsterHunter: /u/kamegami for working on the database, /u/ShadyFigure for fixing Japanese translations and QA, /u/raithian25 for QA, /u/Nicola1975 for additional map data.
Some old friends and anons from /mhg/ provided QA during early stages of development. But they were always screwing around and ended up not helping at all. Thanks anyways guys.
IncognitoMan, dasding, Hairo and Aule for additional content.
McL for stagger part names.
/u/Bunnyapocalips and Janni for German localization.
Ina and Red for French localization. Release Notes: Language switching is now possible for all pages. These pages are indicated by a icon next to them.
icon next to them. Switching between pages for 4th and 3rd generation is also possible. For example Rathian exists in both 4th and 3rd gen shown by the indicator, clicking it will take you to the same page for the other game. This feature only works for individual monsters, items, weapons, armors and skills.
indicator, clicking it will take you to the same page for the other game. This feature only works for individual monsters, items, weapons, armors and skills. Translations are becoming the main bottleneck of the development process since I have to translate a piece of text 6 times. This explains why most tables don't have headers so you'll have to guess what most fields mean for now.
Anything containing the word "dummy" is MH4G exclusive. If you want to view them change your language to Japanese before before clicking the link.
The search bar doesn't actually have search functionality. It will only provide auto-completion and then sends you to the matched page. The auto-completion list is stored in your browser for speed, browsers allow only up to 5MB storage (Chrome will allow 10MB) so if you visit multiple languages and games this will fill up quickly up to a point where it will no longer function. If this happens, clear your browser's localstorage.
Avoid browsing on the 3DS browser since it has very little memory. Stick with the latest version of Chrome to be safe.
I will leave the old MH3U section online, I plan to migrate (i.e. redirect URLs) everything to the new section later this year.
I spent very little time on design so what you see might not be final. | positive |
International Coffee Day Exhibition – Kenya Coffee Producers Association Twitter Facebook Home Welcome to KCPA About us Strategic Objectives Organizational Structures Our Strategic Plan for 2018- 2022 Partners Projects Advocacy Initiatives Members Membership Form Market Information Analysis Contact us Search Menu Blog - Latest News International Coffee Day Exhibition September 25, 2018 /0 Comments/in Uncategorized /by Anne Karanga The international coffee day this year will be celebrated in Kirinyaga County , at General Kassam Stadium in Kianyaga Sub County on 1/10/2018.The event will take the shape of a field day among other activities in order to realize the objective of the event and will be attended by over 2,000 coffee stakeholders. The theme of this year’s international coffee day is women in coffee given the important role women play in the whole of coffee value chain. Join us in this very important event as we celebrate women in coffee. Share this entry Share on Facebook Share on Twitter Share on Google+ Share on Pinterest Share on Linkedin Share on Tumblr Share on Vk Share on Reddit Share by Mail http://kcpa.co.ke/wp-content/uploads/2015/12/kcpalogosm.png 0 0 Anne Karanga http://kcpa.co.ke/wp-content/uploads/2015/12/kcpalogosm.png Anne Karanga2018-09-25 08:00:062018-09-27 13:53:20International Coffee Day Exhibition 0 replies Leave a Reply Want to join the discussion? Feel free to contribute! Leave a Reply Cancel reply Your email address will not be published. Required fields are marked * Comment Name * Email * Website Save my name, email, and website in this browser for the next time I comment. Biogas project Financed by WE EFFECT Recent Posts International Coffee Day Exhibition How to join KCPA Computerized Management Information System project, financed by Agriterra. Coffee Reference Point (CRP) Project financed by HIVOS Strengthening Small Holder Farmer Participation in the Coffee Value Chain (SSFPP) Project Financed by WE EFFECT Kenya Coffee Producers Association, Wakulima House 4th Floor, P.O Box 8100-00300, Nairobi, Kenya Phone Contact : +254 748 141 214 How to join KCPA Scroll to top | negative |
Have you been un-apologetically supporting Donald Trump?
Do you want to Make America Great Again and put America First?
Can you stump for Trump?!
We want you!!!
The Hayride‘s Political Reporter John Binder is looking for 5-6 unique Trump supporters across the state in areas in or around the following:
Greater New Orleans area
New Orleans, La.
Jefferson Parish
Acadiana Louisiana
Jefferson Davis
Lake Charles
Lafayette, La.
Breaux Bridge, La.
North Louisiana
Bossier City, La.
Shreveport, La.
Florida Parishes
Baton Rouge, La.
Central Louisiana
Natchitoches, La.
A diverse range of avid Trump supporters who know exactly why The Donald is their man should send an email to [email protected] with your name, age, where you live in the state, what you do for a living, how long you’ve been supporting Trump and a photo of yourself would help, though it’s not necessary at this stage.
If the area where you live is not listed, email John Binder anyways with the criteria above! All are welcome!
This is an exclusive project to those who are interested and chosen for the project. Hope to hear from fellow Trumpkins!
MAKE AMERICA GREAT AGAIN! | positive |
It continued in this vein in question time – an utterly hysterical bit of political overkill that tried to turn the government's mortification over the fact that, on the face of it, the Deputy Prime Minister shouldn't be sitting in the Parliament – into a Labor conspiracy, because someone in the ALP dared to ask someone in New Zealand to check up on citizenship requirements.
The overkill only added to the sense that the government really doesn't have a clue about political strategy, and how, under pressure, it falls to pieces, rather than finds a path through one of those grin and bear it phases of politics which its own rhetoric suggests is underway.
After all, the government keeps telling us it is confident that Barnaby Joyce's position will ultimately be supported by the High Court, which means the current unpleasantness will all go away in a couple of months. It just has to weather the storm.
Instead, it carries on like a bunch of hysterics and, almost like clockwork, also managed to lose a vote in the House of Representatives.
Is the normal business of government able to carry on in these circumstances? Well, negotiations in the Senate over media reforms – which feel like they have been going on for years – reached a new point on Tuesday when One Nation was given the nod by the government to go out and announce it had done a deal to give conditional support to the government's reforms.
The conditions include what can only be seen as both some intense political payback by a minor party damaged by ABC's Four Corners and by questioning on Insiders which helped undo its Western Australian election campaign, and of more concern, an entrenchment in the political system of a commercial assault on the ABC by the private media companies.
It's not clear the One Nation amendments will ultimately succeed – other crossbench players remain concerned and are still trading. But if the One Nation amendments get up, there will be a star chamber inquiry challenging the rights of the ABC to exist and an obligation on the broadcaster to reveal its employees' remuneration.
In the meantime, the government has allowed itself to look like One Nation is setting the terms of the media debate. | positive |
Podiatry Residency | Jersey Shore University Medical Center Find a Doctor Find a Location Hospitals Children's Hospitals Urgent Care Physician Offices Laboratories All locations Services Behavioral Health Cancer Care Children's Health Convenient Care Heart Care Neuroscience Orthopedics Primary Care Rehabilitation All Services MyChart Pay Bill Billing and Insurance Financial Assistance Price Estimates Donate Donate Now Foundation Events Foundation Leadership Foundation News Give to a Cause Honor or Remembrance Gifts Other Ways To Give Planned Gifts and Bequests 1-844-HMH-WELL Menu Find a Doctor Find a Location Hospitals Children's Hospitals Urgent Care Physician Offices Laboratories All locations Services Behavioral Health Cancer Care Children's Health Convenient Care Heart Care Neuroscience Orthopedics Primary Care Rehabilitation All Services MyChart Pay Bill Billing and Insurance Financial Assistance Price Estimates Donate Donate Now Foundation Events Foundation Leadership Foundation News Give to a Cause Honor or Remembrance Gifts Other Ways To Give Planned Gifts and Bequests 1-844-HMH-WELL Covid-19 Information - Vaccination, Visitation and Testing Info More information here. Podiatric Surgery Residency Overview Residents Home > Medical Education > Jersey Shore University Medical Center > Podiatry Residency > Podiatry Residency Program Overview Watch our Program Overview Video Jersey Shore University Medical Center offers a Podiatric Medicine and Surgery Residency program with an added credential in Reconstructive Rearfoot/Ankle Surgery (PMSR/RRA). This is the only one of its kind in Monmouth and Ocean counties. The program trains podiatry graduates to provide state-of-the-art care and includes three years of training. As of 2020, we have expanded to accept three residents per year. Under the leadership of James Sullivan, D.P.M., residency program director, residents work closely with multiple podiatric surgeons, orthopedic surgeons, as well as physicians in other specialties. The podiatry residency provides residents with the knowledge, expertise, and support to become well-rounded surgical specialists by offering a friendly collegial program with outstanding learning opportunities. We offer challenging cases and a dedicated teaching staff who strive to educate well rounded and confident podiatry foot and ankle surgeons. Residents gain clinical experience in a resident run clinic at the Jane Booker Family Health Center, as well as in the wound healing center located on site within the hospital. Welcome Message from the Program Director From the program’s inception, we have had a vision to provide an excellent and well-rounded education for our residents and students, thanks to a dedicated and well trained faculty of podiatric and non-podiatric physicians. We have a wide variety of attending physicians who provide a very diverse surgical caseload to enhance the training of our residents; many of whom are attending board certified by ABFAS with certification in Rearfoot and Reconstructive Ankle Surgery. As program director, I have made the education of the residents a priority and I am constantly looking for ways to enhance the surgical training experience and academic advancement of our residents. To ensure that, we have medical and surgical subspecialty training rotations, a strong working relationship with Orthopedic Surgeons, as well as Plastic and Vascular Surgeons. While at Jersey Shore, our residents have a very high volume of patient encounters in both the inpatient and outpatient environments. We have affiliation agreements for additional surgical cases with: Ocean Medical Center, Surgical Institute, the Northern Monmouth Regional Surgical Center, Metropolitan Surgical Institute and Advanced Endoscopy and Surgical Center. We take pride in training our residents with hands on experience to provide the best possible care and outcomes for our patients. Additionally, Monmouth County is a great place to live and work. The local area has fantastic restaurants and nightlife, as well as great beaches and outdoor activities available for your “down time “ entertainment and enjoyment. Thank you for your interest in the Podiatric Surgical Training Program at Jersey Shore University Medical Center. I hope to have the opportunity to meet and work with you in the future. Sincerely, James P. Sullivan, D.P.M. Program Overview Watch our Program Overview Video Jersey Shore University Medical Center offers a Podiatric Medicine and Surgery Residency program with an added credential in Reconstructive Rearfoot/Ankle Surgery (PMSR/RRA). This is the only one of its kind in Monmouth and Ocean counties. The program trains podiatry graduates to provide state-of-the-art care and includes three years of training. As of 2020, we have expanded to accept three residents per year. Under the leadership of James Sullivan, D.P.M., residency program director, residents work closely with multiple podiatric surgeons, orthopedic surgeons, as well as physicians in other specialties. The podiatry residency provides residents with the knowledge, expertise, and support to become well-rounded surgical specialists by offering a friendly collegial program with outstanding learning opportunities. We offer challenging cases and a dedicated teaching staff who strive to educate well rounded and confident podiatry foot and ankle surgeons. Residents gain clinical experience in a resident run clinic at the Jane Booker Family Health Center, as well as in the wound healing center located on site within the hospital. © 2022 Hackensack Meridian Health About Hackensack Meridian Health About Us Classes and Events Social Media Community Guidelines Contact Us Community Resources Patients and Visitors Privacy Policy Terms & Conditions Patient Financial Services Nondiscrimination Philosophy Newsroom Careers Careers Nursing Careers Physician Careers For Providers Maestro For Team Members Current Team Member Careers Employee Assistance Program Team Member Login For Employers Employers Solutions Keeping America Safe X We use cookies to improve your site experience. By using this site, you agree to our Terms & Conditions. Also, please read our Privacy Policy. Accept All Cookies | negative |
Steven Spielberg and Zaillian collaborated on Schinder's List. Spielberg also produced and directed the movie Munich.
It is hoped that the film will be ready by 2015, in time for the 100th Anniversary of the Armenian Genocide. The date of the beginning of the Armenian Genocide is conventionally held to be April 24, 1915, the day that Ottoman authorities arrested some 250 Armenian intellectuals and community leaders in Constantinople.
The Armenian Genocide has also been called the Armenian Massacres and, by Armenians, the Great Crime. The number of Armenian deaths is generally held to have been between one and one and a half million.
Turkey continues to deny the existence of the Armenian Genocide ever occurred. Instead, Turkey says that while that during World War I, many Armenians died, the number of Armenian victims has been greatly inflated.
The country continues to face calls to accept the events of that period as genocide. Reportedly, to date, twenty countries have officially recognized the events of the period as genocide. Most historians also accept this view.
Gevorg Gevorgyan, Director of the Armenfilm studio and of the National Film Center in Yerevan said, "By the 100th anniversary of the Armenian Genocide we must show the world a film that would be even more impressive than Mayrik or Ararat. Armenian and foreign actors will play in the film." | positive |
Pearl Bangles - My Fine Look Skip to content (209)597-1497 [email protected] My Fine Look Cue The Color All ProductsAnklets (36)Bangles (18)Bindi (30)Boy's Clothing (4)Earrings (51)Earrings with Maang Tikka (38)Expedited Shipping (1)Floral Jewelry (9)Girl's Clothing (2)Hair Accessories (5)Kalire (6)Kamarband (2)Kurta (24)Maang Tikka (2)Necklace Sets (109)New Arrivals (179)Nose Ring (21)Passa (2)Readymade Suits (40)Rings (8)Sahara (9)Uncategorized (1)Unstitched Suit (4) 0 $0.00 Menu JEWELRY Necklace Sets Floral Jewelry Earrings with Maang Tikka Earrings Nose Ring Anklets Bangles Sahara Rings Passa Maang Tikka Bindi Hair Accessories CLOTHING Unstitched Suit Readymade Suits Kurta Girl’s Clothing Boy’s Clothing New Arrivals CUSTOMIZED SUITS MY ACCOUNT CONTACT US BRIDAL Kalire Expedited Shipping Expedited Shipping CART Pearl Bangles Home Products Pearl Bangles Home / Bangles / Pearl Bangles Pearl Bangles $20.00 USD GBP EUR CAD AED Size Choose an option2.62.8 Clear Pearl Bangles quantity Add to cart SKU: N/A Category: Bangles Description Additional information Reviews (0) Description These pearl bangles comes in a set of 2 bangles. Ready to ship right to your door! Additional information Size 2.6, 2.8 Reviews There are no reviews yet. Be the first to review “Pearl Bangles” Cancel reply Your email address will not be published. Required fields are marked * Your rating * Rate…PerfectGoodAverageNot that badVery poor Your review * Name * Email * Save my name, email, and website in this browser for the next time I comment. Related products Sold out! American Diamond Bangles $36.00 Select options Kundan Bangles $30.00 Select options Jhumki Dangle Bracelet $18.00 Add to cart Multicolor Bangles $20.00 Select options Search for: Search Product categories Anklets Bangles Bindi Boy's Clothing Discount Boxes Earrings Earrings with Maang Tikka Expedited Shipping Floral Jewelry Girl's Clothing Hair Accessories Kalire Kamarband Kurta Maang Tikka Necklace Sets New Arrivals Nose Ring Passa Readymade Suits Rings Sahara Uncategorized Unstitched Suit All Rights Reserved © My Fine Look | No Returns or Exchanges Select your currency USDUnited States (US) dollar GBPPound sterling EUREuro CADCanadian dollar AEDUnited Arab Emirates dirham {{{ data.variation.price_html }}} {{{ data.variation.availability_html }}} | negative |
Website Search
ID 11219
Description:
T. Roosevelt letter to C. Davenport about "degenerates reproducing"
Transcript:
Image 1242 American Philosophical Society Library, Permission Necessary for Reproduction. The Outlook 287 Fourth Avenue New York Lawrence F. Abbott President William B. Howland Treasurer Karl V.S. Howland Secretary Lyman Abbott Editor in Chief Hamilton W. Mable Associate Editor Theodore Roosevelt Contributing Editor January 3rd 1913. My dear Mr. Davenport: I am greatly interested in the two memoirs you have sent me. They are very instructive, and, from the standpoint of our country, very ominous. You say that these people are not themselves responsible, that it is "society" that is responsible. I agree with you if you mean, as I suppose you do, that society has no business to permit degenerates to reproduce their kind. It is really extraordinary that our people refuse to apply to human beings such elementary knowledge as every successful farmer is obliged to apply to his own stock breeding. Any group of farmers who permitted their best stock not to breed, and let all the increase come from the worst stock, would be treated as fit inmates for an asylum. Yet we fail to understand that such conduct is rational compared to the conduct of a nation which permits unlimited breeding from the worst stocks, physically and morally, while it encourages or connives at the cold selfishness or the twisted sentimentality as a result of which the men and women ought to marry, and if married have large families, remain celebates or have no children or only one or two. Some day we will realize that the prime duty the inescapable duty of the good citizen of the right type is to leave his or her blood behind him in the world; and that we have no business to permit the perpetuation of citizens of the wrong type. [type obscured] Faithfully yours, [signed] Theodore Roosevelt Charles B. Davenport, Esq., Cold Spring Harbor, L.I. [stamped]C.B. DAVENPORT PAPERS AP[obs type] [end] | positive |
With life's spectacular diversity, it's easy to look at some of its more baroque features and wonder "how could that have possibly evolved?" When researchers look at the actual molecular details, however, there are often rather mundane answers to that question.
One of the latest was provided in a paper released earlier this week by PNAS, which looked at the reason that fireflies are able to glow. The protein that illuminates the bugs, luciferase, turns out to be closely related to one that's normally involved in basic fat metabolism. In the new paper, researchers show that, given the right chemical, the enzyme that's used to make fat can also cause the cells of a fruit fly to glow. Sadly, attempts to feed the chemical to Drosophila failed to make them bioluminescent.
Proteins are made of a long string of subunits called amino acids. Each position in the string can be occupied by any one of 20 different amino acids; the precise order in which they appear dictates the protein's structure and function. When two proteins are related by common descent (that is, both are derived from the same ancestral protein), the sequences of the amino acids will be similar—a similarity that's shared with the DNA that encodes the proteins.
So, once researchers cloned the gene for the firefly protein that catalyzes the glow reaction, they were able to determine whether it had any relatives in the genomes of insects. And, not surprisingly, it did: fatty acyl-CoA synthetase. This is an enzyme that plays a key role in fat metabolism, creating an intermediary that allows cells to add more carbons onto growing chains of fatty acids. The firefly protein, called luciferase, catalyzes a very similar reaction, but works with a specialized chemical that produces a lot of light.
So, we know that luciferase didn't get magically poofed into existence. But if you put fatty acyl-CoA synthetase in with the specialized chemical that makes fireflies glow, nothing happens. This raised the question of how the ability to produce light began to be selected for in the first place; if there's no light, there's nothing to select.
The authors of the new paper, based at the University of Massachusetts Medical School, reasoned that the process must have started with a mundane, non-glowing fatty acyl-CoA synthetase. If that was identical, then it probably meant that the glow came from a less specialized chemical. So they began testing relatives of the firefly chemical, using the fatty acyl-CoA synthetase from the fruit fly Drosophila. They quickly found a chemical that, when given to Drosophila cells, caused them to emit a dull, red glow. If they put the fly version of fatty acyl-CoA synthetase into human cells, giving them the same chemical would cause them to glow, as well.
Sadly, the one thing that failed was feeding the chemical to living flies. "In principle, the presence of a latent luciferase in fruit flies means that these insects could be rendered bioluminescent if treated with [our chemical] CycLuc2," the authors note. "However, we were unable to detect bioluminescence from fruit flies fed food containing 100 μM CycLuc2."
The results suggest that a random accident—getting the right chemical in cells with a particular enzyme—provided enough glow for evolution to start selecting for it. And, with enough time, both the chemical and the enzyme became specialized, producing a brighter, more intense glow. And, if you've ever seen a night sky filled with fireflies, you'll know it's a pretty spectacular end point for an enzyme that started out making fat.
PNAS, 2014. DOI: 10.1073/pnas.1319300111 (About DOIs). | positive |
CTV Montreal
The union that represents Montreal's police officers is calling for an end to ticket quotas.
The Montreal Police Brotherhood said the quota system in place requires many police officers to issue upwards of 18 tickets a day, and the obligation to meet quotas can mean fewer police services to the public.
“It’s only to get more money, to bring more money to City Hall,” said Yves Francoeur, the president of the Police Brotherhood.
It's no secret that Montreal police officers on traffic patrol have ticket quotas, but Francoeur said the quotas are interfering with public safety.
"For the Montreal police bikers, it's 18 tickets a day," said Francoeur. "For the traffic squad it's 16 and depending on the staffing of a police station, it's between 450 and 1500 for a month."
Francoeur said that this is a problem for several reasons, one of which is that if a station is not going to hit its quota, commanders will frequently take officers on patrol and order them to do nothing but hand out tickets.
The union chief said this means that for several days each month, officers are told not to respond to any emergency calls unless someone's life is in danger, so calls regarding events such as thefts will be ignored. On those days, victims of car theft or burglary could wait hours for a police officer to respond, said Francoeur.
Francoeur said in addition to the negligence of public safety caused by ticket quotas, they are also used to evaluate police officers hoping for a promotion.
"We are not opposed to giving tickets, but for promotion or evaluation we need a regulation because the officers should not be evaluated only on how many tickets they give," said Francoeur.
The union wants Quebec to adopt the same policy in place in 22 American states and eliminate quotas.
“If we compare to the United States, you have 22 states out of 50 - close to 50 per cent - where they have special regulation to prohibit quotas,” said Francoeur.
A letter on the matter has been sent to Public Security Minister Lise Theriault. The minister would say only that she has received the letter but hasn't read it.
The union says the quota system is also used to evaluate each officer’s performance and when that officer is being considered for promotion. They say they want the practice stopped.
“We are not opposed to giving tickets, but for promotion or evaluation what we say is we need a regulation,” said Francoeur.
The Montreal police department refused to speak to CTV Montreal about the issue of ticket quotas, saying only that police officers working in the traffic division are expected to hand out tickets and enforce the Highway Safety Code.
The police brotherhood has a history of bringing up quotas prior to and during contract negotiations.
Currently municipal unions across Quebec are outraged over provincial legislation that would require workers to contribute half of the cost of their pension plan. | positive |
Legal marijuana’s eternal existential struggle will be with kids. The laudable goal of protecting our nation’s youth from drugs—including cannabis, which, even the most staunch advocate of legalization must admit, isn’t something adolescents should be using recreationally—is one of the chief arguments against ending cannabis prohibition, and is also frequently deployed whenever restrictions on legal marijuana products and marketing are suggested.
But how strict is too strict? This issue is playing out in Nevada now, where a ban on all candy-like edibles—gummies, chocolates, and any other recognizable treat with added sugar as well as cannabis—appears to have support in the state Legislature.
Senate Bill 344 would ban edible marijuana products with added sugar, with an exception for baked goods like cookies, brownies, and (presumably) baked alaska. It would ban outright the use of “cartoon characters, mascots, action figures, balloons, fruit or toys” on labeling, and it also outlaws cannabis products “modeled after a brand of products primarily consumed by children, such as gummy bears or Teddy Grahams,” according to the Reno-Gazette Journal.
Bill sponsor Sen. Patricia Farley of Las Vegas told the paper that these prohibitions are “only the start.” Her goal is to outlaw all cannabis products that include sugar—including all edibles—and she also wants to ban cannabis products that use “primary colors that might appeal to youth.”
Which, since both youth and adults tend to be drawn towards sweet-tasting products in bright packaging, would lead to a near-total revamp of the edibles industry in Nevada. (Bland, Soylent-like cannabis sludge, anyone?)
Nevada state lawmakers are scheduled to discuss and possibly amend the bill in an April 12 work session. Other possible future regulations include opaque packaging for all cannabis edibles, and a limit on the amount of THC allowed in each edible.
Joe Pollock, a deputy administrator for the Nevada Department of Health, which regulates cannabis products, told the newspaper that his agency is pushing for a limit of 25 milligrams of THC per edible serving. (A standard dose for first-timers, and many people who consume cannabis regularly, is 10 milligrams. For comparison’s sake, there are products on the market that contain several hundred milligrams, and some “super-strength” edibles that boast of 1,000 milligrams.)
There is an argument to be made here. In other states, including states where cannabis is still illegal, lollipops, gummy worms, and other candies laden with marijuana are popping up in schools. Though police have been exaggerating about the threat, it’s gained some public attention–and in nearly every case, the product was made legally in a legal state.
The Nevada cannabis industry, of course, is not feeling it. Both the state Libertarian Party and some medical-marijuana advocates argue that alcohol and gambling—the literal lifebloods of the Las Vegas economy, without which the city would be a barren stretch of desert—are allowed to use bright colors and mascots.
But some industry leaders have been agitating against the bill in a way that’s not impressing lawmakers. Some cannabis industry figures want to be able to continue to use cartoons on their labeling and produce cannabis in familiar candy-like shapes like gummy worms, which one Republican lawmaker called “disgusting.”
“This is about greed over child safety,” fumed Sen. Michael Roberson, R-Las Vegas, according to the paper.
Or is it? While keeping cannabis away from kids is a commendable goal—and has precedent; banning cigarette companies from using cute cartoons like Joe Camel in advertising may have helped reduce tobacco consumption in the United States—this is at least somewhat a solution in search of a problem.
As data from every state to legalize cannabis has shown, the rate of marijuana use among teens has not increased post-legalization. Meanwhile, rates of childhood obesity, buoyed in part by the legal over-consumption of sugary products marketed to kids, upon which there are almost no restrictions, have tripled since the 1970s.
And obesity, which leads to health complications like diabetes and heart disease as well as missed days of school and work, is absolutely and undoubtedly a killer. Many of the top ten causes of death in the United States—including heart disease, stroke, diabetes—have causes in common that stem from poor diet and excessive weight.
If Farley or Roberson or Nevada or anyone else really wanted to save the children via government prohibition, they would go after sugar. But as we all know, after decades of indoctrination, from Nixon through to Just Say No, marijuana is a much easier target.
According to the newspaper, one concerned member of the public, a registered ER nurse, asked for the edible restrictions to be applied to another extremely popular, often mindbending product that has a track record of “accidentally” killing people: pharmaceuticals. Her modest proposal was met with crickets.
So as usual, we’ll go after the new devil in town, rather than the one lurking right now in our pantries, refrigerators, and in our bodies. | positive |
07057 Navy Blue Bone - Rogers Jig RussLock® (61953L SS) | Case Knives at East Texas Hardware pocket knife knives Toggle navigation East Texas Hardware Case® Authorized Exclusive Master Dealer * Free shipping on purchases $49.99 lower 48 States Cart  0 HOME Shop Our Store View All CASE KNIVES INTERNET SPECIALS NEW RELEASES Collections & Actual Pictures (you will receive knife in pics) 6.5 BONESTAG SS & CV ABALONE ACCESSORIES AMBER BONE SS & CV AMERICAN WORKMAN Antique Bone Barnboard ANTIQUE BONE SS Aqua Kirinite® SparXX™ Autumn Maple Burl Wood Barehead Sawcut Jig Amber Bone BLACK MICARTA Black Smooth Synthetic W/ Quatrerfoil Red Shield BLUE BONE SS Blue G-10 BOY SCOUTS OF AMERICA BRILLIANT GREEN BONE BROWN BONE WITH ARROW SHIELD BROWN SYNTHETIC BUFFALO HORN Burnt Cream Bone Barnboard Jig CAMO CARIBBEAN BLUE BONE CAYENNE BONE CRANDALL JIG CHESTNUT JIGGED BONE Chevrolet CHRISTMAS Color Wash Natural Bone COMMEMORATIVES COPPERHEAD 2021 FROM THE VAULT Crandall Jig Cabernet Bone Damascus DARK RED BONE-CV Dark Red Bone Smooth SS DUCKS UNLIMITED Ebony Wood with Worked Bolster EVERYTHING ELSE EXECUTIVE TRAPPER CANVAS SERIES EXOTIC KNIVES FORD MOTOR CO. GENUINE STAG GIFT SETS Giraffe Bone GRAY BONE Gray Synthetic-arrow shield Green & Black Carbon Fiber/G-10 Weave HALLOWEEN KNIVES Harley-Davidson® Collection HOLIDAY KNIVES HUNTER GREEN BONE ICHTHUS SERIES Image XX War Series Natural Bone Trapper JADE BONE KINFOLK JIG Jigged Purple Bone JOHN DEERE JOHN WAYNE KITCHEN CUTLERY Kinzua™ EDC Lockbacks KIRINITE BLACK PEARL KIRINITE GOLD STARDUST LARGE LOCKBACKS LIMITED EDITION XXXVI SECOND CUT AUTUMN BONE 2020 Lightweight Orange Hunter MARILLA LOCKBACKS Mediterranean Blue Bone MOTHER OF PEARL Natural Bone CV Natural Bone Smooth NAVY BLUE BONE Navy Blue Synthetic Old Red Bone Olive Green Bone - Russell Jig ORANGE SYNTHETIC OUTDOOR & HUNTING FIXED BLADES PATRIOT KIRINITE™ PILOT TEST RUN - RARE Pocket Hunter from the Vault 2020 Pocket Worn Case Knives Pocket Worn® 25th Anniversary Olive Green Bone - Peach Seed Jig Pocket Worn® Antique Bone Pocket Worn® Bermuda Green Bone Pocket Worn® Burnt Brown Case Knives Pocket Worn Grey Bone Pocket Worn® Harvest Orange Bone Pocket Worn® Old Red Bone PURPLE BONE Red & Black Carbon Fiber/G-10 Weave Red & Black Micarta® Red Smooth G-10 RED SPARKLE KIRINITE RED STAG Red Synthetic RELIGIOUS SAYINGS RETIRED CASE KNIVES Rough Black Rustic Red Richlite 2021 Sawcut Dark Molasses Bone Sawcut Hunter Green Bone SELECT KNIVES Shark Tooth Flipper SHOT SHOW SMOOTH BLACK/GREEN/NATURAL CANVAS MICARTA SMOOTH CHESTNUT BONE SparXX SparXX™Blue Pearl Kirinite® SparXX™ Green Pearl Kirinite® SPORTSMAN SERIES Star Spangled Patriotic Tang Stamp Series - Peach Seed Jig Olive Green Bone Tested XX Era Tony Bose® HT Trapper Tony Bose Lanny's Clip 2020 Tony Bose Premium Stockman 2018 Ultraviolet Slanted Worked Bolsters Smooth United States Air Force UNITED STATES ARMY UNITED STATES NAVY UNITED STATES MARINE CORP USA Natural Bone Color Wash Vintage Bone 2020 VINTAGE CASE KNIVES Smooth Purple Curly Maple VAULT KNIFE-CENTER SWELL JACK WAR SERIES / MILITARY White and Black Carbon Weave WHITE SYNTHETIC USA SHIELD Winkler Series WOODCHUCK SERIES WORKED BOLSTERS DARK RED BONE WORKING KNIVES YELLOW SYNTHETIC CV YELLOW SYNTHETIC SS BURNT AMBER BN S35VN STEEL BLACK CURLY MAPLE Shopping Main Page News & Events Payments & Shipping Search Shop 07057 Navy Blue Bone - Rogers Jig RussLock® (61953L SS) 07057 Navy Blue Bone - Rogers Jig RussLock® (61953L SS) $77.99 Required QTY There is only 1 item left in stock. #7057 (61953L SS) RussLock® One-Hand Opening Clip Blade 4 1/4 in / 10.8cm closed; 2.7 oz. Reviews Featured Products Details Pocket guide-anatomy of a Case Knife $2.99 Free Shipping! Details 03573 6.5 BONESTAG TRAPPER SS $69.99 Details 01049 Hobo Sheath Fits Case Hobo Knives $12.99$8.98 Details 01058 Masonic Gift Set - Standard Jig Blue Bone Trapper (6254 SS) in Gift Tin $94.99 Site Links Our Story Contact Us Terms Sign up for coupons and new release information Follow Us OPEN 7 DAYS A WEEK The Case XX logo and Zippo logo are registered trademarks of W. R. Case & Sons Cutlery Company and Zippo Manufacturing Company, respectively. Copyright © 2022 East Texas Hardware - Powered by Online Store × 07057 Navy Blue Bone - Rogers Jig RussLock® (61953L SS) | negative |
Article | In The News | News | U.S. Senator Steve Daines of Montana Skip to primary navigation Skip to content ×Close Meet Steve About Steve Committees Legislative Issues Legislation News Press In The News Montanan Of The Month Videos Connect Email Steve Help With A Federal Agency For Veterans For Students Grants & Resources Visiting DC Flag Requests Scheduling Requests Get Steve's Updates Combating the Meth Epidemic ×Close Sign Up for E-Updates Follow Steve's Montana Travels Steve Daines United States Senator for Montana Steve Daines United States Senator for Montana Meet Steve About Steve Committees Legislative Issues Legislation News Press In The News Montanan Of The Month Videos Connect Email Steve Help With A Federal Agency For Veterans For Students Grants & Resources Visiting DC Flag Requests Scheduling Requests Get Steve's Updates Combating the Meth Epidemic MENU '; var date = ' ' + moment(event.date).format('MMMM D, YYYY') + ' '; //var desc = $(event.desc); // objects are easier to manipulate with script var desc = ''; if (event.thumbnail && event.thumbnail != '') { desc = ' '; } if (event.desc && event.desc != '') { desc += ' ' + event.desc + ' '; } //desc = desc.html(); var details = ' View details '; return date + desc + details; }, 'onPopulate': function(events) { map.listing.empty(); if (events.length == 0) { $(' No Events Found ').appendTo(map.listing); $(' We’re sorry, but we couldn’t find any events. Please try again. ').appendTo(map.listing); } else { $.each(events, function() { var event = this; var mapEntry = $(' ', { 'id': 'event-' + event.id, 'class': 'map-entry' }).appendTo(map.listing); $(' ' + event.city + ', ' + event.state + ' ').appendTo(mapEntry); $(' ' + event.summary + ' ').appendTo(mapEntry); $(' ', { //'html': moment(event.date).format('MMMM D, YYYY @ H:mm A') 'html': moment(event.date).format('MMMM D, YYYY') }).appendTo(mapEntry); var addressEntry = $(' ', { 'class': 'address-entry' }).appendTo(mapEntry) $(' ', { 'html': event.label }).appendTo(addressEntry); if (event.street) { $(' ', { 'html': event.street + ((event.suburb && event.suburb != '') ? ' ' + event.suburb : '') }).appendTo(addressEntry); } $(' ', { 'html': event.city + ', ' + event.state + ' ' + ((event.postcode) ? ' ' + event.postcode : '') }).appendTo(addressEntry); /*var addressString = ((event.street && event.street != '') ? event.street : '') + ((event.suburb && event.suburb != '') ? ' ' + event.suburb : '') + (((event.street && event.street != '') ) ? ' ' : '') + event.city + ', ' + event.state + ((event.postcode) ? ' ' + event.postcode : ''); addressString.trim().replace(/ /g, '+'); $('', { 'html': 'GET DIRECTIONS', 'target': '_blank', 'href': 'https://maps.google.com?daddr=' + encodeURIComponent(addressString) }).appendTo(addressEntry);*/ var descEntry = $(' ', { 'class': 'desc-entry' }).appendTo(mapEntry) $(' ', { 'html': event.desc.replace(/<\/?p>/g, '') }).appendTo(descEntry); $('', { 'html': 'VIEW THIS EVENT ON THE MAP', 'class': 'map-entry-link', 'click': function() { $('html,body').animate({ 'scrollTop': map.container.offset().top - $('#header').height() }, 250); $('#marker-' + event.id).popoverextended('show'); } }).appendTo(descEntry); }); } } }); var geocoder = new google.maps.Geocoder(); map.radius.popoverextended({ 'placement': 'top', 'html': true, 'addClass': 'popover-error', 'container': '#map-container' }); map.postcode.popoverextended({ 'placement': 'top', 'html': true, 'addClass': 'popover-error', 'container': '#map-container' }); map.form.submit(function(e, reset) { e.preventDefault(); map.listing.removeClass('search-results'); reset = (reset) ? reset : false; var radius = map.radius.val(); var postcode = map.postcode.val(); // faux validation if (radius != '' && !/^\d+$/.test(radius)) { map.radius.data('bs.popoverextended').options.content = 'Please enter a valid distance'; map.radius.popoverextended('show'); } else if (postcode != '' && !/^\d{5}(?:[-]\d{4})?$/.test(postcode)) { map.postcode.data('bs.popoverextended').options.content = 'Please enter a valid zip code'; map.postcode.popoverextended('show'); } else if (radius != '' && postcode == '') { map.postcode.data('bs.popoverextended').options.content = 'Please enter a zip code'; map.postcode.popoverextended('show'); } else if (postcode != '' && radius == '') { map.radius.data('bs.popoverextended').options.content = 'Please enter a distance'; map.radius.popoverextended('show'); } else { map.radius.popoverextended('hide'); map.postcode.popoverextended('hide'); var args = { 'year': map.year.val() }; if (radius != '' && postcode != '') { // geocode the zip geocoder.geocode( { 'address': postcode + ' USA' }, function(results, status) { if (status == google.maps.GeocoderStatus.OK) { args.radius = radius; args.lat = results[0].geometry.location.lat(); args.lng = results[0].geometry.location.lng(); args.postcode = postcode; // lat/lng can be arbitrary for a zip, so we also check explicitly against the postcode } if (reset === false) { map.listing.addClass('search-results'); } $('#ceMap').ceMap('get', args); } ); } else { // just get the map if (reset === false) { map.listing.addClass('search-results'); } $('#ceMap').ceMap('get', args); } } }); $('#map-reset').click(function() { map.year.val(''); map.radius.val(''); map.postcode.val(''); map.form.trigger('submit', true); }); }); }); Home News In The News 08.22.16 Bozeman Daily Chronicle: More than 250 turn out for meeting on Yellowstone fire WEST YELLOWSTONE – Smoke rose from thick stands of lodgepole pine just a few miles away as more than 250 people filed into the Union Pacific Dining Hall on Monday night to hear what will be done about the roaring fire in Yellowstone National Park. Several wildfires have been burning in Yellowstone National Park over the last couple of weeks, and the largest, the Maple Fire, has continued to grow. It has now charred more than 22,400 acres — about 35 square miles — in an area near the Gneiss Creek trail and down toward the Madison River. It is now four miles from the park boundary and five miles from West Yellowstone. Growth has taken place mostly to the east and northeast, but fire managers said Monday night that they want to make sure it doesn’t get to the town or any of the homes outside of it. “Basically from here on out the focus is going to be this southwest corner of the fire and the community of West Yellowstone,” said John Cataldo, a fire management officer for Yellowstone. The Maple fire started two weeks ago and is burning heavy, old growth timber. It has burned south toward the Madison River and is nearing the entrance road, but officials said Monday that the road is still open and that they expect to keep it open. Fire behavior analyst Michael Dardis said that while fire weather conditions are expected to improve over the next couple of days, they “expect fire to continue and burn actively in mature timber.” Because of its growth, the Maple fire will no longer be considered part of the Tatanka Complex —a group of fires that have been sharing resources — and will be managed on its own. A Type 2 Incident Management Team will take over the fire this week. On the eastern and northeastern flanks, officials plan to let the fire run its natural course until it starts to threaten structures near the Madison or Norris areas. Cataldo said that as the fire moves toward Mount Holmes, which is just northwest of Norris Geyser Basin, the fire will hit “unfavorable fuels,” like scree fields and rock. On the west side, burnouts are planned for when the fire moves farther in that direction. They are waiting for it to move farther west before starting the burnouts because it is burning an “impenetrable lodgepole thicket,” Cataldo said, and it wouldn’t be safe to send crews into it. “Every inch this thing chews a little closer,” Cataldo said. “It’s putting things in our favor as firefighters. They are hoping that pushing back against the fire with fire will stop it in its tracks, and keep it from inching farther toward West Yellowstone. County officials said residents would be notified if the fire begins to threaten homes or structures, and that residents should begin planning for what they might do if it starts threatening their homes. That time hasn’t come yet, but some at the meeting were clearly on edge about the possibility. Republican U.S. Sen. Steve Daines spoke at the meeting, saying the rising smoke was an “ominous sight,” and that he wanted to ensure that the tourism economy isn’t affected. Yellowstone superintendent Dan Wenk said he has “a lot of confidence” in the plans that the fire crews have made. The other fire near West Yellowstone is the Boundary fire. It has burned 192 acres about a quarter mile from the park’s boundary in the Duck Creek area, and is now 75 percent contained. A 20-person hand crew is still on the fire, but no more growth is expected. By: Michael Wright Source: Bozeman Daily Chronicle Print Email Tweet Previous Article Next Article Home Meet Steve News Connect Photo Credits Privacy Policy | negative |
LS2 HELMETS LS2 Global Website Choose your Country Albanian Algeria Andorra Argentina Australia Austria Azerbaijan Bahrein Bangladesh Belarus Belgium Bermuda Bolivia Bosnia Brazil Bulgaria Cambodia Canada Chile China Colombia Costa Rica Croatia Cyprus Czech republic Denmark Ecuador Egypt Estonia Finland France Georgia Germany Ghana Gibraltar Greece Hungary Iceland India Indonesia Iran Ireland Israel Italy Japan Jordan Kenia Kuwait Latvia Lebanon Lithuania Macedonia Malaysia Malta México Moldava Morocco Nepal Netherlands New Zealand Nigeria Norway Pakistan Paraguay Peru Philippines Poland Portugal Qatar Republic of Mauritius República Dominicana Romania Russia Senegal Serbia Singapore Slovenia South Africa South Korea Spain Sweden Switzerland Thailand Turkey Ukraine United Arab Emirates United Kingdom United States Uruguay Vietnam > Toggle navigation ROAD RACE THUNDER THUNDER FIM TOURING CHALLENGER CARBON CHALLENGER HPFC VECTOR II STORM STREAM EVO RAPID Download here your video of EICMA URBAN COMMUTER ADVANT SCOPE STROBE DOWNTOWN VERSO TWISTER II SPITFIRE SPHERE LUX AIRFLOW COPTER UNLIMITED BOB CARBON BOB INFINITY Download here your video of EICMA OFF ROAD MX X-FORCE SUBVERTER EVO FAST EVO ENDURO DRIFTER EXPLORER C EXPLORER HPFC PIONEER EVO Download here your video of EICMA MINI JUNIOR RAPID MINI FUNNY FAST MINI EVO Download here your video of EICMA GOOGLES GOOGLES AURA AURA PRO Download here your video of EICMA APPAREL GLOVES INFORMATION COMPANY CATALOGUES & MANUALS REGISTER YOUR LS2 HELMET LINKIN RIDE PAL COMMUNITY LS2 RIDERS GALLERY DEALERS 0 Video Gallery Tutorials, experiences LS2 users. All the audiovisual content LS2 find it in our private video gallery. LS2 EXPLORER LS2 THUNDER THUNDER TEASER THE FILM LS2 APPAREL TAILORING MY LIFE CONNECTED TO A MOTORCYCLE. His passion for skateboarding since he was 10 made Yari Copt a lover of art, music, photography... FREEDOM OF MOVEMENTS, FREEDOM OF LIVING. WITH TWISTER OF573. By OSCAR LONDOÑO Experiencing new way of living. Living for the art. Celebrating the art of dance, music and body... NOT TO THINK. JUST FEEL. By JORGE PITTORE Mountain. Speed. Adrenalin. Disconnect. Forget the problems. Enter a trance. Not to think.... NOP ERIKA FERNANDEZ NOP XAVIER PUIGTIO NOP RAQUEL VILA MANOR LEARN FROM OTHER CULTURES... AND ABOUT ONESELF. By Vera Thies. Traveling by motorbike. Getting around the city. Feeling like in a movie. Freedom. Sun. TO LIVE LIFE INTENSEVELY. By Camilo Carvajal. Be alive and make the world around you feel it. The passion for adventure. BEING TRULY FREE. ON THE MOTORCYCLE AS WITH THE MUSIC.
By PAOLA ZUKAR The passion for music that catches you as a striking lightning from an early age. With all its... NOP DEBORA AQUILLINI - SUBVERTER NOP DIDAC LEDESMA ENJOYING OF FREEDOM, WITHOUT A PLANNED ROUTE. By Matteo Casuccio. The passion for the motorcycle that goes back to that distant youth synonymous of freedom, rebell... NOP DINO ROMANO - ARROW CARBON THAT SENSE OF FREEDOM AND RESPONSIBILITY. FEELING FREE. By Guillem & VALIANT The possibility of always choosing, of not depending on anyone, of feeling free. Getting on... THE STRONGER SENSE OF PEACE By PABLO DZG Traveling, changing, feeling the environment, the climate. To abandon the routine, to have... WHEN WORK BECOMES A PASSION. By Juan Ramón & VALIANT Each dawn Joan Ramón is striven by motivation and energy, fruit of the love he feels for his work. LS2 LIGHT MXHOW TO CHANGE THE WORLD AT ONCE By JOSE LUIS STEURI Learning how to fight. Knowing that when you fall you need to stand rapidly and carry on. Devo... ALEX OLIVA & ARROW EVO Dedication in any profession comes from the passion you feel for what you do. LS2 Vector ff397 — Enjoy the route Taste the way. Experience the nature. Share the freedom of the wind. Go through the lost trails.... GOING ALWAYS FORWARD. By ALEX ARAGÓN When you fall, you have to get up. In life as on a motorbike you can not go back. Always forwa... FEELING ALIVE. By SERGI BROSA Moving away from monotony to discover oneself. Release more adrenaline, leave the daily routin... LS2 METRO FF324 FIREFLY CHALLENGING TIME AND SPACE. Defying the speed of time and space, METRO FF324 FIREFLY Black gives a new perspective from... LS2 VECTOR FF397 with EMMA One more day, but never an ordinary one. When one lives with passion nothing is the same and ther... LS2 LIGHT MX456 with IVÁN CERVANTES In his tiring training sessions before the beginning of the 2016 season, Iván Cervantes #25... LS2 with LOBO MOTIVE In his modest studio in Barcelona, Xavi is the brain and the creative hands of motorcycles... LS2 STREAM with JOSE ENTHUSIASM… SPEED. EFFORT. CONSTANCY. WILL. The enthusiasm of a triathlete and... LS2 CABRIO with DAVID Attitude and style in an innovative, open face motorcycle helmet, the Cabrio combines tech- nology... LS2 METRO with JOSE Bold. Innovative. Advanced. Modular. LS2's Metro reimagines the possibilities of a modern,... LS2 ARROW FF323 with Jean Marc Yes, it's HIM. Jean-Marc Manuguerra in full swing. In one of the many tasks he carries out with... FAST MX437: GAME, REALITY AND RISK Our helmet FAST MX437 is one of the best helmets in the market; it is lightweight thanks to... LS2 CABRIO OF597 with LOBO MOTIVE "HANDMADE" MOTORCYCLE WITH UNIQUE IDENTIFYING MARK LOBO Motive Italy LS2 Riders Cookie Policy Privacy Policy Legal Stores Social networks policy Business Login © 2022 ls2helmets.com | All images and videos are for illustration purposes only and the product may vary. | negative |
The Federal Trade Commission has written to search engines operating in the US warning them to "clearly and prominently" distinguish advertising from "natural" search results, saying that over the past decade it has seen companies beginning to mix the two.
The letter (PDF) has been sent to the three largest US search engines – Google, Yahoo and Microsoft's Bing - and also to AOL, Blekko, DuckDuckGo and 17 other specialist search engines for shopping, travel, and local business which display adverts to users.
The FTC, set up to protect US consumers' interests, does not name any search engine company in particular as having breached its rules. But it warns the companies that "consumers ordinarily expect that natural search results are included and ranked based on relevance to a search query, not based on payment from a third party. Including or ranking a search result in whole or in part based on payment is a form of advertising. To avoid the potential for deception, consumers should be able to easily distinguish a natural search result from advertising that a search engine delivers."
It says in the past year, the tendency for search engines to put adverts immediately above "natural" results – as Google and others do – has led more than half of users not to recognise them as adverts. In a survey, nearly half of searchers said the background shading for adverts was white – exactly the opposite of the correct answer, where paid ads above "natural" results are distinguished on almost all search engines by having a non-white background shading. Paid adverts on the right of natural search results have a white background on Google, Bing and Yahoo.
The FTC also says that general search engines which offer specialised services such as news, images, local business or shopping where companies pay to appear should make it clear that they are effectively advertising – and that failing to label them as such would constitute "deceptive practice".
According to the research company eMarketer, Google is the US's most-used search engine, and raked in 73.8% of the $17.3bn (£11.3bn) that was spent on search advertising in 2012 – leaving just $4.5bn for rivals, most of which would have been taken by Yahoo and Bing.
Last year, Google shifted its Shopping search so that it only includes paid listings. The Shopping listings are presented on a panel with a white background – the same as "natural" search results – and with grey text saying "sponsored" at the top right. Above that is a light-shaded panel with a paid ad.
Google said in a statement to the Reuters news agency that clear labelling and disclosure of paid search were important and "we've always strived to do that as our products have evolved."
The FTC in January completed a two-year examination of Google's behaviour in the presentation of search results to see whether it was unfairly favouring its own products such as Maps, YouTube and Shopping. It decided there was no basis to act. | positive |
Search Results for Research Article | AJTMH Jump to Content Jump to Main Navigation Sign in Sign up HOME BROWSE ABOUT THE JOURNAL Editorial Board Journal Facts Open Access Policy Reprints/Permissions Advertising Contact Us Privacy Policy ISSUES Current Issue Previous Issues Future Issues Supplemental Issues AHEAD OF PRINT FOR AUTHORS Submit a Manuscript Author Instructions Journal Policies Transformative Journal Status Author Fees FOR SUBSCRIBERS Members Institutions Cost HELP How to subscribe Forgot Password FAQ COVID-19 ASTMH Advanced Search Help ASTMH Sign in Sign up HOME BROWSE ABOUT THE JOURNAL Editorial Board Journal Facts Open Access Policy Reprints/Permissions Advertising Contact Us Privacy Policy ISSUES Current Issue Previous Issues Future Issues Supplemental Issues AHEAD OF PRINT FOR AUTHORS Submit a Manuscript Author Instructions Journal Policies Transformative Author Fees FOR SUBSCRIBERS Members Institutions Cost HELP How to subscribe Forgot Password FAQ COVID-19 Search Advanced Search Help Search within results Search within results Filter Filter Refine by Access All content Content accessible to me Refine by Date From 2022 2021 2020 2019 2018 2017 2016 2015 2014 2013 2012 2011 2010 2009 2008 2007 2006 2005 2004 2003 2002 2001 2000 1999 1998 1997 1996 1995 1994 1993 1992 1991 1990 1989 1988 1987 1986 1985 1984 1983 1982 1981 1980 1979 1978 1977 1976 1975 1974 1973 1972 1971 1970 1969 1968 1967 1966 1965 1964 1963 1962 1961 1960 1959 1958 1957 1956 1955 1954 1953 1952 1951 1950 1949 1948 1947 1946 1945 1944 1943 1942 1941 1940 1939 1938 1937 1936 1935 1934 1933 1932 1931 1930 1929 1928 1927 1926 1925 1924 1923 1922 1921 — To 2022 2021 2020 2019 2018 2017 2016 2015 2014 2013 2012 2011 2010 2009 2008 2007 2006 2005 2004 2003 2002 2001 2000 1999 1998 1997 1996 1995 1994 1993 1992 1991 1990 1989 1988 1987 1986 1985 1984 1983 1982 1981 1980 1979 1978 1977 1976 1975 1974 1973 1972 1971 1970 1969 1968 1967 1966 1965 1964 1963 1962 1961 1960 1959 1958 1957 1956 1955 1954 1953 1952 1951 1950 1949 1948 1947 1946 1945 1944 1943 1942 1941 1940 1939 1938 1937 1936 1935 1934 1933 1932 1931 1930 1929 1928 1927 1926 1925 1924 1923 1922 1921 Submit Refine by Article Category Research Article (1) Print Save Email this link Share Link Copy this link, or click below to email it to a friend Email this link or copy the link directly: https://www.ajtmh.org/search?access=all&f_0=author&pageSize=10&q_0=Aye+Win&sort=relevance&t=Research+Article The link was not copied. Your current browser may not support copying via this button. Link copied successfully Copy link Search Results You are looking at 1 - 1 of 1 items for : Author or Editor: Aye Win x Research Article x Refine by Access: All content x Clear All Modify Search Items per page: 102050 Sort by: RelevanceDate - Old to RecentDate - Recent to OldArticle A - ZArticle Z - AAuthor A - ZAuthor Z - A Qualitative and Quantitative Analysis of Latrine Management Approaches in Internally Displaced Persons Camps in Myanmar Marta Domini, Sunny Guidotti Pereira, Aye Win, Lae Yee Win, and Daniele Lantagne Volume/Issue: Volume 107: Issue 1 Article Category: Research Article DOI: https://doi.org/10.4269/ajtmh.21-0526 Publication Date: 13 Jul 2022 Restricted access Items per page: 102050 Sort by: RelevanceDate - Old to RecentDate - Recent to OldArticle A - ZArticle Z - AAuthor A - ZAuthor Z - A American Journal of Tropical Medicine and Hygiene 241 18th Street South, Suite 501 Arlington, VA 22202 USA [email protected] © 2022 The American Journal of Tropical Medicine and Hygiene ASTMH CONTACT US TERMS & CONDITIONS PRIVACY POLICY Powered by: PubFactory Powered by PubFactory [18.208.132.74] 18.208.132.74 | negative |
Values - Personal Development - Books | A Mighty Girl Your browser is not supported. For the best experience, you should upgrade to a modern browser with improved speed and security. JavaScript seems to be disabled in your browser. You must have JavaScript enabled in your browser to utilize the functionality of this website. Skip to Menu Skip to Search Skip to Account Books View All Books Mighty Girls & Women Mighty Girls Role Models Women's History Fiction Action / Adventure Classics Fairy Tales / Folktales Fantasy / Science Fiction Graphic Novels Humor Multicultural Fiction Mystery / Suspense Picture Books Realistic Fiction General Interest Animals / Nature Civics / Government Creative Arts Food / Gardening Holidays / Celebrations Jobs / Money Religion / Spirituality Science / Technology Sports / Games Transportation World Regions History / Biography Biography History - United States History - World Personal Development Daily Living Guides for Girls Health / Wellness Life Challenges Relationships Transitions Values Social Issues Abuse / Violence Educational Access Environmental Issues Homelessness Illness / Disease Immigration / Migration Oppression / Repression Poverty / Hardship Prejudice / Discrimination War / Conflict Work / Labor Toys View All Toys Toys / Games Activity Books Building Toys Games / Video Games Geography / History Indoor Active Play Life Skills Toys Puzzles Reading / Literacy Science / Math Tub / Bath Toys Vehicle Toys Imaginative Play Costumes / Dress-up Dolls / Action Figures Dollhouses Play House / Spaces Pretend Play Puppets / Theaters Arts / Crafts Art Tables / Equipment Craft Kits Drawing / Painting Fabric Crafts Music / Instruments Paper / Printing Crafts Woodworking Kits Writing / Journaling Outdoor Play Exploration / Discovery Gardening Movement / Riding Toys Outdoor Games Outdoor Play Spaces Sand / Water Toys Snow / Winter Toys Sports Equipment For Baby Baby Gear Balls / Sports Toys Dolls / Playsets Learning Toys Movement Toys Music Toys Rattles / Teething Soft Toys Kids' Gear Art / Decor Bags / Packs Furniture Mealtime School Supplies Seasonal Movies / TV View All Movies / TV Action / Adventure Animated Comedy Documentary Drama Family Fantasy / Science Fiction Foreign Musical & Performing Arts Mystery / Suspense Romance Sports Music View All Music Children's Country Electronic Folk Hip Hop / Rap Jazz Pop / Rock R&B / Soul Showtunes Soundtrack Story / Spoken Word Clothing Best Of View All Best Of A Mighty Girl's Empowering Easter Gifts Collection A Mighty Girl's Books of the Year Top Read Aloud Books Starring Mighty Girls A Mighty Girl's 2021 Holiday Gift Guide "Small But Mighty" Stocking Stuffers Top Mighty Girl Winter Holiday Stories A Mighty Girl Celebrates Winter Top Graphic Novels Starring Mighty Girls Top Children's Books on the Environment The Ultimate Guide to the Independent Princess Top 100 A Mighty Girl Picture Books Top Books on Bullying Prevention for Mighty Girls Top Mighty Girl Books & Films on Women's History Top Latino / Hispanic American Mighty Girl Books Top Asian Pacific American Mighty Girl Books Top Mighty Girl Books on Civil Rights History Top Mighty Girl School Stories Travel Toys, Games, & Gear for Mighty Girls Top Environmental Movies featuring Mighty Girls 2018 Mighty Girl Books: A Year in Review 2017 Mighty Girl Books: A Year in Review 2016 Mighty Girl Books: A Year in Review 2015 Mighty Girl Books: A Year in Review 2014 Mighty Girl Books: A Year in Review 2013 Mighty Girl Books: A Year in Review Top Halloween Mighty Girl Books & Films A Mighty Girl's Back to School & Learn at Home Guide Top Mighty Girl Books for Graduates Top Children's Books for Celebrating Spring Book Club Character Collection View All Character Collection Book Characters Alice in Wonderland Anne of Green Gables Coraline Dorothy (Wizard of Oz) Hermione Granger Katniss Everdeen Ladybug Girl Laura Ingalls Little Women Lyra Silvertongue Madeline Nancy Drew Olivia Pippi Longstocking Ramona Quimby Uni the Unicorn Historical Characters (A - I) Ada Lovelace Alice Paul Amelia Earhart Annie Oakley Anne Frank Audrey Hepburn Bessie Coleman Coretta Scott King Eleanor Roosevelt Elizabeth Cady Stanton Emily Dickinson Florence Nightingale Frida Kahlo Georgia O'Keeffe Harriet Tubman Helen Keller Ida B. Wells Irena Sendler Historical Characters (I - Z) Jane Austen Jane Goodall Juliette Gordon Low Kamala Harris Katherine Johnson Mae Jemison Malala Yousafzai Marie Curie Mary Anning Mary Shelley Nellie Bly Phillis Wheatley Rachel Carson Rosa Parks Rosie the Riveter Ruby Bridges Ruth Bader Ginsburg Sally Ride Shirley Chisholm Sojourner Truth Sonia Sotomayor Susan B. Anthony Temple Grandin Wangari Maathai Zora Neale Hurston TV / Movie Characters Anna & Elsa (Frozen) Astrid Hofferson Doc McStuffins Dora the Explorer Dory (Finding Dory) Ghostbusters Inside Out Jessie (Toy Story) Judy Hopps (Zootopia) Kai Lan Kiki's Delivery Service Kim Possible Maleficent Mary Poppins Merida (Brave) Moana Ms. Frizzle Mulan Peppa Pig Princess Leia Raya & the Last Dragon Rey (Star Wars) Sally (Nightmare Before Christmas) Spirit Riding Free Star Wars Characters Studio Ghibli WordGirl Superhero Characters Batgirl Buffy Vampire Slayer Captain Marvel DC Comics Marvel Comics Spider-Gwen Supergirl Violet (Incredibles) Wonder Woman Xena Parenting View All Parenting Body Image / Self-Esteem Bullying Child Sexualization Gender Research Healthy Living Inspirational Life Skills Career Development Financial Management Literacy / Book Clubs Responsible Technology Use Safety / Self-Defense Stress Management Media / Commercialization Parent / Child Relationships Father / Daughter Relationships Mother / Daughter Relationships Physical / Emotional Development Special Circumstances Adoption Children with Disabilities LGBTQ Parenting Physical / Mental Illness Blog Search Search {{groupBody}} {{name}} Add To Cart Sign In or Register Email Password Sign In Forgot password? Don’t have an account? Register United States Canada United Kingdom European Union Australia / New Zealand Other The world's largest collection of books, toys and movies for smart, confident, and courageous girls. Home Books Personal Development Values Share This Page: Tweet Values Show Filters Filtering By Category: Hope / Optimism Recommended Age: 13+ (Teen) Price: $40.00 - $59.99 Remove All Price C$60.00 - C$70.00 1 Price £40.00 - £50.00 1 Price A$60.00 - A$70.00 1 Language English 1 1 item Show 9 per page 18 per page 36 per page 100 per page All items Sort Best Value Alphabetical Price: Lowest Price: Highest View Grid List Oz: The Complete Paperback Collection $51.99 C$64.52 A$62.00 £48.11 1 item Show 9 per page 18 per page 36 per page 100 per page All items Sort Best Value Alphabetical Price: Lowest Price: Highest View Grid List A Mighty Girl About Us Blog Wishlist Contact FAQ Follow Us Subscribe to Our Newsletter Email Subscribe Support A Mighty Girl © 2012 - 2022 A Mighty Girl. All rights reserved. Terms Of Use Privacy Policy | negative |
When Boo was adopted, he and his family made a promise to be loyal to each other for life. Sadly, Boo was the only one who kept up his side of the vow.
When his family moved out of their Detroit home several months ago, they left the dog with their discarded furniture on the curb.
Get push notifications with news, features and more.
According to The Dodo, that’s where Boo stayed. For a month, the depressed dog waited for his family to come back, accepting food and water from neighbors but refusing to budge.
Finally, Mike Diesel of Detroit Youth and Dog Rescue decided Boo had waited long enough. He went to Boo’s vigil for his old family on the side of the road and worked on gaining the pup’s trust. For 11 hours he sat with the dog, feeding him tasty snacks and keeping him company. Diesel left that night, but returned the next morning; this time with McDonald’s breakfast.
Recognizing Diesel as a new friend, Boo allowed the rescuer to place a collar on him. The pair spent the next hour or so on a walk and resting in the sun, getting more comfortable with each other by the minute. Eventually, Boo let Diesel pick him up and take him home in his truck.
A visit to the vet revealed that Boo is heartworm positive, which is now being treated, but he is in good health otherwise. Now all he needs is a foster home, or even better a forever home, where his loyalty and love can be truly appreciated.
To learn more about Boo and Detroit Youth and Dog Rescue’s other charitable work, including feeding the homeless on holidays, visit their Facebook page. | positive |
For all of his alleged political smarts, Stephen Harper is surprisingly out of touch with most Canadians when it comes to his fascination with Canada’s former days as a British colony. In recent years, Harper has unilaterally imposed measures that reinforce an image of our prime minister as a man who loves our outdated colonial roots, loves the monarchy and loves all things British.
Stephen Harper is taking Canada back to the past as he tosses out the Maple Leaf rank designation on the uniforms of Canadian Army officers and restores the British army-style stars or "pips" insignia that existed when the Queen visited Toronto in 1959. ( AP file photo )
It’s an image that stands in stark contrast to how most Canadians want to see our country in the 21st century — independent, proud and one that has cast off its last ties to a foreign power. Importantly, Canadians are actively urging Ottawa to distance itself from Britain, not embrace it more closely as Harper is doing. The latest slap at Canada’s independent image came this week when the Harper government announced our army will be tossing out the Canadian-style Maple Leaf rank designation on the shoulders of officers’ uniforms and restoring the traditional British Army-style stars, or “pips,” that existed until the 1960s.
Article Continued Below
Harper also is expected to restore British insignia and rank designations to our air force and navy. “This takes nothing away from the Maple Leaf,” Defence Minister Peter MacKay said defensively in making the official announcement on Monday. “There are other places which the Maple Leaf is honoured,” he added, insisting the move is merely a return to tradition and in no way diminishes Canada’s image as an independent nation. How does this not hurt our image? With this change, Harper has taken the main distinctive Canadian symbol off our military uniforms, the one the world would instantly recognize as “Canada.”
And why order the change at all? There was no obvious pressure either from the public or the military to make the switch, especially after 45 years of having our own insignia and military ranks. It’s especially odd given all the issues facing the military at this time, particularly the huge budget cuts that are coming and the growing concerns over the military’s handling of personnel returning from Afghanistan.
Article Continued Below
The real answer likely lies with Harper’s love affair with British symbols and traditions. In just the last two years, he has restored the word “Royal” to the official name of our navy and air force, ordered our embassies abroad and federal offices at home to display the Queen’s portrait prominently and agreed to have Canadian diplomats share office space in British embassies. When “Royal” was put back into the navy and air force names, MacKay said it was done to correct a “mistake,” a reference to the 1968 decision made by the Liberal government as part of its program to unify the forces. As Harper moves to promote our outdated British ties with silly moves such as ridding the army of the Maple Leaf insignia, most Canadians have long tired of honouring the British royalty and traditions. On Friday, for instance, lawyers will argue in a Toronto courtroom that it is against the Charter to force applicants for citizenship to swear or affirm allegiance to the Queen and her heirs based on their belief that the “monarchy is an anti-democratic relic of the past.” Also, Democracy Watch, a non-profit citizens’ group, launched a national petition two weeks ago to elect U.S. comedian Stephen Colbert as “King of Canada.” The gimmicky campaign is aimed at getting Canadians to think seriously about replacing the Queen with an elected head of state. A national poll conducted in February indicated 55 per cent of Canadians want to dump the British royal family as Canada’s head of state. And barely 15 per cent of us consider the Queen an important symbol of Canada. Given these trends, it’s time Harper realized most Canadians no longer care about British traditions, British royalty or British military insignias. Harper may feel he’s being a smart politician by appealing to his established older, conservative, Anglo base of supporters with his love for the British. By doing so, though, he has shown a stunning lack of understanding for how much Canada has changed in recent decades — and how far we have come from the days when we were British subjects. Bob Hepburn’s column appears Thursday. [email protected]
Read more about: | positive |
During a press conference on Friday, House Minority Leader Representative Nancy Pelosi (D-CA) commented on Donna Brazile’s accusations against the DNC by stating she wants to “focus on what’s really important to our country.”
Pelosi said, “You know what, you haven’t heard me relitigate last year’s election. I wasn’t involved in the presidential. I’m only looking forward. this is about the future. I haven’t had time to be reading any of that anyway, but nonetheless, what I’ve seen on the little tape running across the screen. Let’s focus on what’s really important to our country.”
She added, “I have responsibility for what I have responsibility for. I don’t have any interest in what I don’t have responsibility for when it comes to other campaigns.”
(h/t GOP War Room)
Follow Ian Hanchett on Twitter @IanHanchett | positive |
Phone Mounts - Dream Cyclery Please read into our shipping and pickup policies before making an order here. Account Compare Go to account settings Cart 0 items Submit View all results () Bikes Back Bikes All Bikes Electric Bikes Gravel Bikes Hybrid & Cruiser Bikes Kids Bikes Mountain Bikes Full Suspensions Hard Tails Road Bikes Stationery Bikes All Bikes Electric Bikes Gravel Bikes Hybrid & Cruiser Bikes Kids Bikes Mountain Bikes Back Mountain Bikes All Mountain Bikes Full Suspensions Hard Tails Road Bikes Stationery Bikes Accessory Back Accessory All Accessory Bags Baskets & Racks Baskets Rear Racks Bells Bottles & Bottle Cages Bottles Bottle Cages Cycling Computers Fenders & Mud Guards Grips & Bar tapes Bar Tapes Grips Bar End Plugs Headphones Kickstands Lights Mirrors Locks & Security Maintenance Multi-Tools Pedals Cleats Phone Mounts Saddles & Saddle Covers Saddles Saddle Covers All Accessory Bags Baskets & Racks Back Baskets & Racks All Baskets & Racks Baskets Rear Racks Bells Bottles & Bottle Cages Back Bottles & Bottle Cages All Bottles & Bottle Cages Bottles Bottle Cages Cycling Computers Fenders & Mud Guards Grips & Bar tapes Back Grips & Bar tapes All Grips & Bar tapes Bar Tapes Grips Bar End Plugs Headphones Kickstands Lights Mirrors Locks & Security Maintenance Multi-Tools Pedals Back Pedals All Pedals Cleats Phone Mounts Saddles & Saddle Covers Back Saddles & Saddle Covers All Saddles & Saddle Covers Saddles Saddle Covers Apparel Back Apparel All Apparel Bibs & Shorts Bibtights & Knickers Gloves Helmets Jackets Jerseys Protection Shades Shoes Socks All Apparel Bibs & Shorts Bibtights & Knickers Gloves Helmets Jackets Jerseys Protection Shades Shoes Socks Car Racks & Trailers Back Car Racks & Trailers All Car Racks & Trailers Car Racks Car Rack Accessories Child Seats Trailers All Car Racks & Trailers Car Racks Back Car Racks All Car Racks Car Rack Accessories Child Seats Trailers Parts Back Parts All Parts Forks Bottom Brackets Brakes Brake Cables Brake Levers Brake Pads Brake Parts Cassettes Chains Chain Guides Chainrings Cranksets Derailleurs Derailleur Hangers Di2 Wires Groupsets Handlebars Shift Levers Shift Levers Stem All Parts Forks Bottom Brackets Brakes Back Brakes All Brakes Brake Cables Brake Levers Brake Pads Brake Parts Cassettes Chains Chain Guides Chainrings Cranksets Derailleurs Derailleur Hangers Di2 Wires Groupsets Handlebars Shift Levers Shift Levers Stem Trainers Back Trainers All Trainers Indoor Trainers Trainer Accessories All Trainers Indoor Trainers Trainer Accessories Tires & Tubes Back Tires & Tubes All Tires & Tubes Fat Tires Gravel Tires Mountain Tires Pumps Road Tires Tubes & Tubeless Tubes Tubeless Valves Sealants Tools and Maintenance Winter Tires All Tires & Tubes Fat Tires Gravel Tires Mountain Tires Pumps Road Tires Tubes & Tubeless Back Tubes & Tubeless All Tubes & Tubeless Tubes Tubeless Back Tubeless All Tubeless Valves Sealants Tools and Maintenance Winter Tires Wheels Back Wheels All Wheels Carbon Wheels Training Wheels All Wheels Carbon Wheels Training Wheels Sale Back Sale All Sale Accessories Apparel Bikes Frames & Forks Helmets Trainers Wheels All Sale Accessories Apparel Bikes Frames & Forks Helmets Trainers Wheels Cart 0 items Submit View all results () Compare Phone Mounts Show filters Categories Bikes Electric Bikes Gravel Bikes Hybrid & Cruiser Bikes Kids Bikes Mountain Bikes Full Suspensions Hard Tails Road Bikes Stationery Bikes Accessory Bags Baskets & Racks Baskets Rear Racks Bells Bottles & Bottle Cages Bottles Bottle Cages Cycling Computers Fenders & Mud Guards Grips & Bar tapes Bar Tapes Grips Bar End Plugs Headphones Kickstands Lights Mirrors Locks & Security Maintenance Multi-Tools Pedals Cleats Phone Mounts Saddles & Saddle Covers Saddles Saddle Covers Apparel Bibs & Shorts Bibtights & Knickers Gloves Helmets Jackets Jerseys Protection Shades Shoes Socks Car Racks & Trailers Car Racks Car Rack Accessories Child Seats Trailers Parts Forks Bottom Brackets Brakes Brake Cables Brake Levers Brake Pads Brake Parts Cassettes Chains Chain Guides Chainrings Cranksets Derailleurs Derailleur Hangers Di2 Wires Groupsets Handlebars Shift Levers Shift Levers Stem Trainers Indoor Trainers Trainer Accessories Tires & Tubes Fat Tires Gravel Tires Mountain Tires Pumps Road Tires Tubes & Tubeless Tubes Tubeless Tools and Maintenance Winter Tires Wheels Carbon Wheels Training Wheels Sale Accessories Apparel Bikes Frames & Forks Helmets Trainers Wheels Brands All brands 49N Delta LIZARD SKINS Topeak Price Min price Max price C$0 - C$100 10 results Sort — Default Popularity Newest products Lowest price Highest price Name ascending Name descending Filters Close panel Categories Active categories: Bikes Electric Bikes Gravel Bikes Hybrid & Cruiser Bikes Kids Bikes Mountain Bikes Full Suspensions Hard Tails Road Bikes Stationery Bikes Accessory Bags Baskets & Racks Baskets Rear Racks Bells Bottles & Bottle Cages Bottles Bottle Cages Cycling Computers Fenders & Mud Guards Grips & Bar tapes Bar Tapes Grips Bar End Plugs Headphones Kickstands Lights Mirrors Locks & Security Maintenance Multi-Tools Pedals Cleats Phone Mounts Saddles & Saddle Covers Saddles Saddle Covers Apparel Bibs & Shorts Bibtights & Knickers Gloves Helmets Jackets Jerseys Protection Shades Shoes Socks Car Racks & Trailers Car Racks Car Rack Accessories Child Seats Trailers Parts Forks Bottom Brackets Brakes Brake Cables Brake Levers Brake Pads Brake Parts Cassettes Chains Chain Guides Chainrings Cranksets Derailleurs Derailleur Hangers Di2 Wires Groupsets Handlebars Shift Levers Shift Levers Stem Trainers Indoor Trainers Trainer Accessories Tires & Tubes Fat Tires Gravel Tires Mountain Tires Pumps Road Tires Tubes & Tubeless Tubes Tubeless Tools and Maintenance Winter Tires Wheels Carbon Wheels Training Wheels Sale Accessories Apparel Bikes Frames & Forks Helmets Trainers Wheels Brands Active brans: All brands 49N Delta LIZARD SKINS Topeak Price range Active prices: Min price Max price C$0 - C$100 Topeak Topeak DEFENDER XC1 & XC11 MTB SET $99.99 Add to cart Loading LIZARD SKINS LIZARD SKINS NEOPRENE CHAINSTAY PROTECTORS $18.99 Choose options Topeak Topeak DEFENDER RX REAR $26.99 Add to cart Loading Delta Delta X Pro $49.98 Add to cart Loading Delta Delta Smart Phone Holder $49.99 Add to cart Loading 49N 49N 26"-29" ALLOY STAY DISC KICKSTAND $39.99 Add to cart Loading Topeak Topeak DEFENDER RC11 REAR $34.99 Add to cart Loading Topeak Topeak DEFENDER M1 & XC11 FOR 29'ER $73.99 Add to cart Loading Delta Delta Smart Phone Holder XL $49.99 Add to cart Loading Delta Delta Hefty+ Deluxe Phone Holder $64.99 Add to cart Loading Go to top of page Canadian owned Secure payments Easy returns Free shipping On orders above $99 Shop Accessory Apparel Bikes Car Racks & Trailers Parts Trainers Tires & Tubes Wheels Sale Company About Us Customer Support Disclaimer General Terms and Conditions Shipping and Returns Store Hours and Directions Services Bike Storage Custom Wheelsets Pickup and Delivery Services and Repair © Copyright 2022 Dream Cyclery RSS feed Follow us on Instagram Your cart — 0 You cart is currently empty Close drawer panel Cart details Login Email Password Forgot? Login Close drawer panel Don't have an account? Get started By using our website, you agree to the usage of cookies to help us make this website better. Hide this message More on cookies » | negative |
Reports regarding emergence of a new terror group ‘Base Movement’ has been making rounds for some time. The ramifications, reach and consequences of this terror group, however has not been analyzed to any degree. Least to say, the ramifications are pernicious.
The Base Movement, which has been carrying out revenge blasts, came into existence in January 2015 at Madurai in Tamil Nadu. This group is affiliated to the Al-Qaeda.
It is pertinent to mention here that the Al-Qaeda continues to be the umbrella organization of all jihadi groups rooted in the Wahabi / Salafi philosophy. It includes outfits like Haqqani group, Tehrik-e-Taliban Pakistan (TTP), Lashkar-e-Toiba (LeT), Jaish-e-Mohammad (JeM), Lashkar-e-Jhangvi (LeJ), Jundulah, JMB, Al-Nusra, Boko-Haram etc. Hafiz Saeed was put in under preventive detention on 17 December 2008, this was a week before the US Security Council designated Jamat-ul-Dawa (JuD), the parent organization of LeT as an associate of Al-Qaeda.
The arrival of the Islamic State or the inroads by Al-Qaeda in India poses danger not only to the Hindu-Muslim fabric of the country but more grievously on the Shia-Sunni harmony.
Significantly, the Islamic State is also under the same umbrella. This is a loose conglomeration andmost jihadi groups do not necessarily take all the orders from the Al-Qaeda. To that extent they are autonomous.
The autonomy is imperative because respective groups have their respective catchment, and operational areas, given their local / regional expertise. For example, the catchment area of LeT is the Sialkot region and that of JeM is the Bhawalpur region. This architecture of global jihad cannot sustain without this arrangement. The Islamic State catchment area is the entire globe, wherein it attracts educated, English speaking, media and social network savvy youth, cutting across nationalities. Curiously a medical student from Hyderabad in Pakistan joined the Islamic State in Syria. She was in contact with a boy on social media for quite some-time, who transformed her mindset. Interestingly, two of Leghari’s friends were Hindus.
All jihadi groups in the world have some basic commonalities, i.e. opposition to the West, extremist narrative, designation of US and Israel as primary enemies, and the concept of Caliphate. The difference between the Al-Qaeda and the Islamic State on territorial issues is that the former has no immediate concern for ‘Caliphate’, while the latter has been insisting on its immediate establishment, and accordingly carved a territory for itself in Iraq and Syria. Also while the Al-Qaeda believes in large scale dramatic attacks to mobilize the Muslims of the world, the Islamic State seeks targets that are closer to home. The other major difference is that though both Al-Qaeda and Islamic State are anti-Shia, the Al-Qaeda believes in postponement of its anti-Shia agenda, but looks the other way when other affiliates like Lashkar-e-Jhangvi carries out terrorist attacks against Shias. On the other hand, the Islamic State believes in immediate and total annihilation of Shias.
The biggest beneficiaries of Hindu-Muslim clashes in India are the jihadi groups because it provides them a rich crop to harvest jihadis from.
It is instructive for Indians to know the mindset of the Islamic State. Significantly it was Jama’at al-Tawhidwal-Jihad (Al-Qaeda in Iraq), which had morphed into Islamic State. The leader of Al-Qaeda in Iraq Abu Musab al-Zarqawi (killed in 2006) and later Abu Bakr al-Baghdadi ignored the Al-Qaeda’s main leader Aymanal-Zawahiri’sadvise against killing of Shias. In a letter to Al-Zawahiri in 2004, Al-Zarqawi wrote that he would continue targeting the Shias to provoke them to retaliate against the Sunnis in order to compel the latter to gravitate to the fold of Islamic State. Till this day, the Islamic State follows the same strategy.
The arrival of the Islamic State or the inroads by Al-Qaeda in India poses danger not only to the Hindu-Muslim fabric of the country but more grievously on the Shia-Sunni harmony. The rise of the Islamic State has made the Shias in India restive to the extent that about 300 Shias had gathered in Lucknow clamoring for a special flight to Syria so that they could fight for the protection of Shia Shrines in West Asia.
Zakir Naik therefore not only posed the Wahabi menace in India, he was a serious threat to the sectarian balance amongst Muslims. Moreover, the Islamic State philosophy of provoking other sects / groups to draw Muslims to its brand of jihad may already have been tried in India manifesting in communal clashes. The biggest beneficiaries of Hindu-Muslim clashes in India are the jihadi groups because it provides them a rich crop to harvest jihadis from.
Coming back to ‘Base Movement’, this new terror group has carried out five blasts in different Court premises in southern part of India. These, as per the admission of its members were carried out in revenge against so-called victimization of Muslims in rest of India. The first bomb attack on 15-June-2016 was carried out in Kollam Court against the encounter killing of Ishrat Jahan. The second attack was carried on 01-August-2016 in the Mysore Court because of hanging of Yakub Menon and killing of eight terrorists of SIMI in Madhya Pradesh. The third attack was in Nellore Court on 12-September-2016 following the killing of Burhan Wani.
…this is the first time that the judiciary has been under threat as part of a comprehensive design. It adds a new dimension to India’s threat perception.
As per the NIA charge-sheet, the jihadis of the organization were asked to identify offices in Tamil Nadu, Karnataka, Andhra Pradesh, Delhi and Mumbai. It indicates that the targets being explored by the Base Movement are not confined to South India but Mumbai and Delhi as well. In fact, the entire India for them is an arena of revenge. Also on their target is the French consulate in Bengaluru.
The NIA has very timely exposed this dangerous development of Base Movement. Earlier, the targets were parliament and legislative assemblies or security forces or infrastructure, but this is the first time that the judiciary has been under threat as part of a comprehensive design. It adds a new dimension to India’s threat perception. Also, on their hit-list are the Prime Minister, Home Minister, LK Advani and Gen VK Singh.
Significantly, it is not only the French Consulate in Bengaluru under threat, but the Embassies of US, Russia, France, Israel and Myanmar located in Delhi as well.
This jihadi threat to foreign embassies must be assessed in the backdrop of the massive bomb attack in the diplomatic area of Kabul on 31-May-2017 during Ramadan. More than 100 people lost their lives and more than 300 were wounded. Since the emergence of Islamic State, jihadi attacks during Ramadan has become an essential feature. An official Taliban spokesman said: “our fight is jihad and is an obligatory worship, reward for every obligatory act of worship is multiplied 70 times in Ramadan.” Islamic State has recently called for bloodshed during Ramadan exhorting its cadres ‘attack them in their homes’. The Islamic State emphasis on attacks abroad during Ramadan is to galvanize their followers and demonstrate their reach. In 2015, the ISIS killed nearly 400 people across the globe during Ramadan. In 2016, the figure ratcheted to nearly 480 and this year till today attacks attributed to the ISIS directly or indirectly include Britain (2 attacks), Kabul (2 attacks), Baghdad (2 attacks), Kashmir (4 suicide attacks), and Manila.
The threat to consulates and embassies by the Base Movement must draw lessons from recent attack in Kabul. Being a diplomatic area it was heavily fortified. The bombing was only 100 meters away from the Indian Embassy in Kabul. The French, German and Japanese embassy suffered damages. The jihadi group responsible for this attack has not been identified but its philosophy is no different from Base Movement.
If setback to jihadis in Kashmir or in Madhya Pradesh, has reverberations in the judicial courts in South India or foreign embassies or consulates, surely then we are in throes of global jihad. It is not merely Kashmir and Kerala (euphemistically speaking for South India) connection or pan-Indian phenomenon but the alignment is Kerala, Kashmir and Kabul, and other co-laterals of global jihad extending to West Asia, Southeast Asia and even Maldives.
The impact of a jihadi attack or incident in Kashmir is not limited to J&K region, it triggers chain reactions throughout India and of course amongst jihadi outfits in Pakistan and Bangladesh.
To these three ‘K’si i.e. Kerela, Kashmir and Kabul can also be added another one, i.e. Kokrajhar. In may be remembered that in the year 2012, communal clashes in the Arakan region of Myanmar, wherein the Rohingyas suffered had its ugly reverberations in Kokrajhar in Assam, which in turn incited communal violence in Mumbai and then there was a chain of communal incidents in Pune, Hyderabad and Bengaluru. Boys and girls from Northeast had to flee the city of Bengaluru in fear, such is the pan-Indian and global dimension of jihad in the Indian context.
Therefore, it would be suicidal for India to treat jihadi terror in the perspective of ‘law and order’. It is a grave security problem, which has external and internal dimensions with the dividing line getting increasingly blurred. The impact of a jihadi attack or incident in Kashmir is not limited to J&K region, it triggers chain reactions throughout India and of course amongst jihadi outfits in Pakistan and Bangladesh.
It is thus, all the more pressing that Article-370 be removed.
If Indian Muslims from Kerala are travelling to Afghanistan to join the Islamic State and if Kashmir has reverberations on the Muslims of Kerala, then one is compelled to deduce that the global jihad in India has transcended all geographical, linguistic and cultural barriers. | positive |
Right now there are two patients in every room. One is made with flesh, bones, and blood. One is made with a monitor, a mouse, and a keyboard.
Both demand my time.
Both demand my concentration.
A little over two weeks ago I wrote the short story Please Choose One. I posted it online. The response it generated exceeded anything I could have ever imagined. It struck a nerve. People contacted me from all over the world, from all walks of life, about the story. Everyone, it seems, can relate to the challenge of having to choose between a person and a screen.
People sent me all kinds of suggestions and ideas. A few sent words of encouragement. Yet, what struck me the most about the people who contacted me was what they did not say. Not a single IT person argued the computer was more important than the patient. Not a single healthcare provider stated they wanted more time with the screen and less time with the patient. And finally, most importantly, not a single patient wrote me and said they wished their doctor or nurse spent more time typing and less time listening.
Medicine is the art of the subtle- the resentful glance from the mother of the newborn presenting with the suspicious bruise, the solitary bead of sweat running down the temple of the fifty three year old truck driver complaining of reflux, the slight flush on the face of the teenage girl when asked if she is having thoughts of hurting herself. These things matter. And these same things are missed when our eyes are on the screen instead of the patient.
I get it. We need to collect the data on patients. In the modern world, medicine is also a business- a business of collecting, sorting, and collating data for billing purposes. I am not naïve enough to believe or argue otherwise. But maybe right now we need to step back and ask ourselves the one question no one seems to want to ask:
Has the data we store about the patients somehow become more important than the actual flesh and blood patients themselves?
One of the most difficult things to do in the practice of medicine is to recognize when a previously established diagnosis is incorrect. It requires having an open mind that maybe, just maybe, the prior five doctors have been wrong. I wonder if we are at a similar point. Maybe we do not need another screen in the room, another page of data, another flag popping up on the screen warning us to address some incomplete part of the patient’s record. Maybe instead, we just need to spend those thirty seconds interacting with our patients.
Computers, EMRs, and patient databases are ultimately a good thing. We need them. I have no doubt that we will reach the point when they can collect all the data they need without inserting themselves between the doctor and the patient. But we are not there yet.
To the IT people out there who were offended by the story, my message to you is clear. You are the very ones who can help save us. Keep working, keep innovating, keep looking for ways to build a better, more invisible system that still does what it needs to do. After hearing from so many concerned people in the IT industry, I have nothing but faith we will find our way together. Ultimately I am reminded that we all want the same thing: to do what is best for the patient.
I am looking forward to the day when I step into a room and there are two providers. One made with flesh, bones, and blood. One made with a monitor, a mouse, and a keyboard.
Both advocates for the patient.
©Philip Allen Green
Trauma Room Two: Stories from the ER is out now on Amazon
Follow me on Twitter. | positive |
buildd log scanner -- issues in package r-cran-huge -- Debian Quality Assurance QA Skip Quicknav About Debian Getting Debian Support Developers' Corner Debian Quality Assurance / buildd log scanner Issues found in current buildd logs for r-cran-huge: W dpkg-buildflags-missing CPPFLAGS 6 (of 6), CXXFLAGS 6 (of 6) missing (hppa, kfreebsd-amd64, kfreebsd-i386) Found 1 issues. Scanned logs (date is the date the log was generated, not the date it was scanned): alpha 1.3.5-1 2021-09-20 13:04 amd64 1.3.5-1+b1 2022-09-18 20:19 arm64 1.3.5-1+b1 2022-09-18 16:59 armel 1.3.5-1+b1 2022-09-18 21:11 armhf 1.3.5-1+b1 2022-09-19 07:14 hppa 1.3.5-1 2021-09-20 12:42 hurd-i386 1.3.5-1 2021-09-20 18:21 i386 1.3.5-1+b1 2022-09-19 09:37 ia64 1.3.5-1 2021-09-20 12:19 kfreebsd-amd64 1.3.5-1 2021-09-22 11:57 kfreebsd-i386 1.3.5-1 2021-09-22 18:45 m68k 1.3.5-1 2021-09-20 12:38 mips64el 1.3.5-1+b1 2022-09-19 13:51 mipsel 1.3.5-1+b1 2022-09-19 12:27 powerpc 1.3.5-1 2021-09-20 12:39 ppc64 1.3.5-1 2021-09-20 12:17 ppc64el 1.3.5-1+b1 2022-09-18 21:42 riscv64 1.3.5-1 2021-09-20 12:21 s390x 1.3.5-1+b1 2022-09-19 05:52 sh4 1.3.5-1 2021-09-20 12:38 sparc64 1.3.5-1 2021-09-20 12:30 x32 1.3.5-1 2021-09-20 12:26 Back to the Debian Project homepage. To report a problem with the QA web site, file a bug on the qa.debian.org pseudo-package, or e-mail [email protected]. For other contact information, see the Debian contact page. Made by Bernhard R. Link. 2022-09-24 14:39 UTC Copyright © 1997-2015 SPI; See license terms Debian is a registered trademark of Software in the Public Interest, Inc. | negative |
“Should I tell the story about the killer robots?” Micah Weinberg said. “I love telling this story. It’s such a good story.”
A group of roughly 50 people listened raptly as Weinberg, president of a think tank called the Bay Area Council Economic Institute, addressed a public-policy luncheon in San Carlos, California, on Thursday afternoon. The event—whose guests of honor included Democratic lawmakers Ro Khanna, who represents Silicon Valley, and Tim Ryan, from the Thirteenth District of Ohio—was meant to foster a lively discussion about connecting Silicon Valley “to the heartland.” There would also be a sneak peek of a report showing the economic impact of Bay Area companies on every single congressional district in America. (Spoiler alert: The impact is awesome.)
Weinberg began his killer story as the crowd—including the mayor of Akron, Ohio; Silicon Valley municipal leaders; health care executives; business school academics; tech investors; representatives from Oracle and Palantir; and a Teamsters rep—made quick work of the carb-heavy boxed lunches. His tale was set in Alabama, which Weinberg claimed has spent almost half a billion dollars to attract auto-parts manufacturers to the state. The incentives brought in about 25,000 jobs, but the work is low-paying and dangerous. “Apparently one of the things that happens in these factories is that the robots that are making these parts and cars do a lot of maiming and, unfortunately, some killing of the folks that work there,” he said, teeing up his punch line. Companies in the Bay Area, on the other hand, have brought 27,000 jobs with higher average wages to the state, without incentives. “And I don’t think that our robots have killed anybody,” Weinberg said.
The humblebrag capper on an anecdote about deadly labor conditions drew a few clipped laughs, but the message was clear: Forget what you’ve heard. Silicon Valley is already tied to the heartland—and is here to propel the American dream.
Silicon Valley vs. Ohio Valley
Thursday’s event took place in a makeshift auditorium in the San Mateo Transportation Authority building. (After the event, Weinberg told WIRED that the luncheon was held in the transportation building as a reminder that financial support for the Bay Area touches on many other industries.) Lighting rigs hung from the ceiling of a large room that normally functions as a studio for a local TV station. A dozen or so folding tables had been arranged into a wobbly rectangle so long that you had to squint to read the name cards in front of each assigned seat.
Over the course of two hours, the luncheon played out like a good cop/bad cop routine around Silicon Valley’s role in creating vs. destroying jobs. On a wall-sized screen, Weinberg flashed slides from the upcoming report, showing that Bay Area companies are responsible for 50,000 jobs paying $2.5 billion in wages to residents in Ohio, including 763 jobs and $37 million in Ryan’s district. His presentation seemed to respond, word for word, to criticisms of Silicon Valley’s greed. “The rising tide in the Bay Area actually does lift all boats, throughout the country, so it’s really not zero-sum,” Weinberg said.
The report arrives in the midst of a populist backlash against the tech industry. Critics say Silicon Valley lacks accountability for the consequences of its staggering growth. As fears about job displacement from automation rise, so has a sense that technological progress will continue to concentrate wealth in the hands of a few.
During the forum, the institute’s representative argued that the Bay Area’s economic gains are already distributed around the country. Meanwhile, Khanna, whose largest donors included Alphabet, Salesforce, Oracle, and three venture capital firms, advocated for more equitable access to opportunity and for Silicon Valley to approach the rest of the nation with more humility. “There are hard-working entrepreneurial people across this country,” said Khanna, who had recently completed a trip to Appalachia to win over hearts and minds in coal country. “Are we really doing enough of a job imaging where talent is?” Ninety percent of venture capital funding goes to just three states—California, Massachusetts, and New York—he said. “It’s not clear to me [why] Steve Jobs couldn’t be born in Alabama or Mississippi.”
Representative Ryan had a slightly different agenda, but it dovetailed with Khanna’s thoughts and the report. He wants to convince growing tech companies to consider expanding in places like Akron, where commercial space is about $10 per square foot. (Last year, office rents in San Francisco hit $78 per square foot.) If employers paid an engineering graduate $40,000 to $50,000 a year, “that person would be the most loyal employee you’ve ever seen in your life, because those opportunities aren’t there,” he said. (A recent PayScale survey found that the median salary for an entry-level software engineer in San Francisco is $108,000.)
Ryan had a hype man in the audience to that effect: Patrick McKenna, a private equity investor and startup entrepreneur from San Francisco, who brought a delegation of 14 Silicon Valley founders and investors to visit an incubator in Youngstown, Ohio, back in March. “I reached out and said, ‘Hey guys, let’s see what’s going on with this country and see if we can help,’ ” McKenna said.
All the speakers—the congressmembers, Weinberg, and McKenna—evoked an optimistic vision of an efficient labor market that works for everyone, a vision at odds with the revanchist rhetoric of the Trump administration. The tech industry could hire cheaper labor, located in cheaper offices, by training workers around the country for exactly the skill set they need. Workers, in turn, would get a chance to participate in the new economy and find better job security.
The only thing missing from the discussion? A concrete plan for how to set this all in motion.
From the Valley to the Hill
The sole action item on the agenda came from Representative Ryan, who suggested that Youngstown and Akron open up offices in Silicon Valley to knock on doors and sponsor cocktail parties. Khanna made no demands of the tech giants in his district, such as a pledge to hire or retrain workers outside of California. In this way, Thursday’s policy discussion resembled the post-election rebranding efforts of tech CEOs like Mark Zuckerberg, who is in the midst of his own whistlestop tour.
Silicon Valley’s need to overhaul its image became evident at the end of the lunch, during a Q&A period in which rebuke came from one of Khanna’s own constituents. Doug Bloch, the political director at the local chapter of the Teamsters, told Khanna that he was concerned automation in self-driving trucks would have the same result as closures of steel plants and coal mines: the loss of a lot of good union jobs. “Representative Khanna, I’m glad you mentioned Luddites. We’re not Luddites, we’re not against innovation, but we believe that workers and their representatives should be partners in those innovations and not unintended consequences or casualties.”
Around the table, a few heads nodded in agreement.
In fact, Khanna had mentioned the Luddites at the start of the discussion to note that they got a bad rap. “They were destroying machinery of companies that they felt were not fair or were abusive or had the equivalent of killer robots,” he said. After Bloch’s pointed comments, Khanna concurred. There is no silver bullet solution, he said; nonetheless, “there’s so much wealth generated here there’s a greater obligation, in my judgment, to make sure that that is distributed in a way that accounts for people who are being displaced.”
At this point, Ryan eagerly interjected. “It’s like they’re in one of the conversations we have on the House floor,” he told Khanna, before addressing the room: “You’re, like, in our heads right now!”
Ultimately, the folks on the House floor—and elsewhere in DC—may be the most urgent audience for this image of a kinder, more generous Silicon Valley. In order to improve infrastructure, develop the local workforce, or create affordable housing, the region will need federal cooperation, as well as cooperation from other states.
After the lunch, Weinberg told WIRED that the report was assembled in advance of the Bay Area Council’s trip to Washington, DC. “Frankly, it’s obvious that California and Washington don’t always see eye to eye—particularly these days.” So it’s important to convince people that “we share an economic destiny, rather than being in competition with each other.” | positive |
"Why should man value himself as more than a small part of the one great unit of creation ?" - John Muir.[1] John Muir (1838-1914), one of the main inspirations for the U.S. national park system.- John Muir.
The protected areas of the United States are managed by an array of different federal, state, tribal and local level authorities and receive widely varying levels of protection. Some areas are managed as wilderness, while others are operated with acceptable commercial exploitation. As of 2015 , the 25,800 protected areas covered 1,294,476 km2 (499,800 sq mi), or 14 percent of the land area of the United States.[2] This is also one-tenth of the protected land area of the world. The U.S. also had a total of 787 National Marine Protected Areas, covering an additional 1,271,408 km2 (490,893 sq mi), or 12 percent of the total marine area of the United States.[2]
Some areas are managed in concert between levels of government. The Father Marquette National Memorial is an example of a federal park operated by a state park system, while Kal-Haven Trail is an example of a state park operated by county-level government.
Federal level protected areas [ edit ]
As of 2007 , according to the United Nations Environment Programme, the U.S. had a total of 6,770 terrestrial nationally designated (federal) protected areas. Federal level protected areas are managed by a variety of agencies, most of which are a part of the National Park Service, a bureau of the United States Department of the Interior. They are often considered the crown jewels of the protected areas. Other areas are managed by the United States Forest Service, the Bureau of Land Management and the United States Fish and Wildlife Service. The United States Army Corps of Engineers is claimed to provide 30 percent of the recreational opportunities on federal lands, mainly through lakes and waterways that they manage.
The highest levels of protection, as described by the International Union for Conservation of Nature (IUCN), are Level I (Strict Nature Reserves & Wilderness Areas) and Level II (National Parks). The United States maintains 12 percent of the Level I and II lands in the world. These lands had a total area of 210,000 sq mi (540,000 km2).[citation needed]
A confusing system for naming protected areas results in some types being used by more than one agency. For instance, both the National Park Service and the U.S. Forest Service operate areas designated National Preserves and National Recreation Areas. The National Park Service, the U.S. Forest Service, and the Bureau of Land Management operate areas called National Monuments. National Wilderness Areas are designated within other protected areas, managed by various agencies and sometimes wilderness areas span areas managed by multiple agencies.
There are existing federal designations of historic or landmark status that may support preservation via tax incentives, but that do not necessarily convey any protection, including a listing on the National Register of Historic Places or a designation as a National Historic Landmark. States and local zoning bodies may or may not choose to protect these. The state of Colorado, for example, is very clear that it does not set any limits on owners of NRHP properties.[3]
Federal protected area designations[1]
International protected area designations
State level protected areas [ edit ]
Every state has a system of state parks. State parks vary widely from urban parks to very large parks that are on a par with national parks. Some state parks, like Adirondack Park, are similar to the national parks of England and Wales, with numerous towns inside the borders of the park. About half the area of the park, some 3,000,000 acres (1,200,000 ha), is state-owned and preserved as "forever wild" by the Forest Preserve of New York. Wood-Tikchik State Park in Alaska is the largest state park by the amount of contiguous protected land; it is larger than many U.S. National Parks, with some 1,600,000 acres (650,000 ha), making it larger than the state of Delaware. Many states also operate game and recreation areas.
Local level protected areas [ edit ]
Various counties, cities, metropolitan authorities, regional parks, townships, soil conservation districts and other units manage a variety of local level parks. Some of these are little more than picnic areas or playgrounds; however, others are extensive nature reserves. South Mountain Park in Phoenix, Arizona, for example, is called the largest city park in the United States; it spans 25 sq mi (65 km2) and contains 58 mi (93 km) of trails.
List of protected areas by region [ edit ] | positive |
Cheekbones, check. Pout, check. Whippet-thin body, check. At first glance the latest crop of models don't seem like they stray from the fashion business's usual beauty rules, but look closer and it's clear something has shifted on the catwalks.
Models such as Stella Tennant and Agyness Deyn have been a staple of magazine covers for years, but model bookers are now taking this androgynous aesthetic a step further.
Ford models has signed Casey Legler, a bequiffed 35-year-old woman with a cheerful gap-toothed grin and razor-sharp cheekbones – to model menswear.
Brazilian transsexual model Lea T on the catwalk in Rio. Photograph: Felipe Dana/AP
The trend started with Lea T, a transsexual model who became the face of Givenchy, made the cover of Elle – and was soon pictured snogging Kate Moss for Love magazine. The distinctive Brazilian started modelling women's fashion while still physically male and, by the time she underwent sex reassignment surgery last year, was already a fixture in the fashion world. The first internationally successful transsexual model, she was photographed naked for Vogue, hiding her male genitals with her hand. But as someone who identifies herself as a woman, her place in women's fashion magazines is hardly a surprise.
Andrej Pejic modelling for Jean Paul Gaultier. Photograph: Pascal Le Segretain/Getty Images
But then came the delicately featured Andrej Pejic. The Bosnian started out as a male model, but was soon modelling women's clothes for designers including Jean Paul Gaultier. This year he opened a show in a wedding dress at Barcelona's bridal week.
Following hot on his high heels is Ukrainian Stav Strashko who made waves in a red bikini when he starred in a Toyota advert. Legler, a former Olympic swimmer, told Time that Pejic's success has opened the door for models cross-dressing. "This is a unique little moment that fashion is allowing to have happen," she says. Although celebrities have been on the trend for slightly longer – it's been two years since Tilda Swinton modelled menswear for Pringle.
Reading this on mobile? Click here to view
Stealing all the limelight now, meanwhile, is the Voguing Chinese grandfather Liu Xianping who at the age of 72 is reported to have said he was helping his granddaughter unpack her stock for her online fashion store when he started giving her advice on how to style the clothes. The playful photographs of him modelling her wares have become an online sensation – and apparently increased sales five-fold.
Liu Xianping, 72-year-old Chinese male model. Photograph: Lu Tin/AFP/Getty Images
So what's behind this new appetite for the androgynous look? Is it a sign the fashion world is opening its arms to reflect the diversity of our bodies – or just the latest fad to provide shock value now Crystal Renn has lost weight?
Legler herself thinks it is a way of exposing how stifling strict gender roles can be: "We have very strict ways in which we identify ourselves as men or women and I think that those can sometimes be limiting … Seeing me on the men's board … speaks to a notion of freedom, you know. There's something really bold about that … it's saying there is also this other way and it's really rad."
But social commentator Bidisha says she is sceptical about the idea that the models suggest the industry is increasingly willing to soften its strict standards of beauty. "I love fashion, style and design but I am cynical about the fashion industry. They will do whatever results in a cultural buzz that will turn into sales and money. What fashion says is: 'You can be transsexual, you can be androgynous, you can be old, you can be young, you can be larger than a size 12 but you must still be as beautiful as all the other models.' Their wallet lives on the side of the status quo." | positive |
SL-1301-BAQ/A - Certified Skip to content Close Subscribe & Save New Arrivals & Special Offers straight to your inbox Your email Subscribe ✆ 718-435-2800 / 9AM - 5PM EST / Mon-Thu Subscribe & Save All Categories Shop by brand About Contact Need help? Call us 718-435-2800 Back All Categories Video Surveillance Intercom Systems Access Control Fire & Alarm Networking Audio & Entertainment Tools & Test Equipment Power & Cable Smart Home Back Video Surveillance Security Cameras Recorders Complete Kits CCTV Accessories Back Intercom Systems Intercom Kits Panels & Faceplates Intercom Monitors Door Hardware Add-ons & Installation Nurse Call Back Access Control Readers & Keypads Controllers Credentials Door Hardware Request to Exit Access Control Accessories Back Fire & Alarm Fire Control Panels Fire Detection Devices Alarm Keypads Fire Pull Stations Notifications Devices Voice Evacuation Systems Back Networking Network Switches Access Points Routers Racks & Cabinets Network Accessories Back Audio & Entertainment Monitors Speakers Amplifiers AV Receivers Cables & Accessories Mounts Back Tools & Test Equipment Tool Kits Crimpers, Strippers & Cutters Hand Tools Fish Tapes & Poles Termination Tools Back Power & Cable Batteries Power Supplies Wire Cable Connectors Cable Concealer Relays Certified Alarm Distributors Clear Close Login / Signup My account Login to my account Enter your e-mail and password: Email Password Login New customer? Create your account Lost password? Recover password Recover password Enter your email: Email Recover Remembered your password? Back to login 0 Cart Your cart is empty Shop our products All Categories Video Surveillance Security Cameras Recorders Complete Kits CCTV Accessories Intercom Systems Intercom Kits Panels & Faceplates Intercom Monitors Door Hardware Add-ons & Installation Nurse Call Access Control Readers & Keypads Controllers Credentials Door Hardware Request to Exit Access Control Accessories Fire & Alarm Fire Control Panels Fire Detection Devices Alarm Keypads Fire Pull Stations Notifications Devices Voice Evacuation Systems Networking Network Switches Access Points Routers Racks & Cabinets Network Accessories Audio & Entertainment Monitors Speakers Amplifiers AV Receivers Cables & Accessories Mounts Tools & Test Equipment Tool Kits Crimpers, Strippers & Cutters Hand Tools Fish Tapes & Poles Termination Tools Power & Cable Batteries Power Supplies Wire Cable Connectors Cable Concealer Relays Smart Home Shop by brand About Contact Home All products SL-1301-BAQ/A Roll over image to zoom in Click on image to zoom / SL-1301-BAQ/A Save $-34.25 Seco-LarmSKU: SL-1301-BAQ/A Price: Sale price$34.25 / Stock: On order. Order now to get it first. Quantity: Add to cart Our team of experts is a phone call away! Questions? Call us at 718- 435-2800 Share this product Description 9~15 VDC LED Strobe Light. Incorporates 20 LEDs. 50,000-Hour operating life. Six different flash patterns. Adjustable flashing speed. Indoor/outdoor use. Amber lens. Payment & Security American Express Apple Pay Diners Club Discover Meta Pay Google Pay Mastercard Shop Pay Visa Your payment information is processed securely. We do not store credit card details nor have access to your credit card information. You may also like Recently viewed Free delivery in USA Minimum order quantity may apply Satisfied or refunded Piece of mind from end-to-end Trusted support Get the high quality support you deserve Secure payments Industry leading security standards About Certified Alarm Distributors In the ever-changing low voltage industry, we provide over 40 years of experience to bring peace of mind to our customers, in every project. From expert advice, to industry leading customer support, dedicated account manager and more, we have your back every step of the way. Read our story Company About us Brands we distribute Contact us Information Privacy Policy Refund Policy Terms of Service Do not sell my personal information Be in the know! New Arrivals & Special Offers straight to your email Your email Subscribe Country/region United States (USD $) Country/region Afghanistan (USD $) Åland Islands (USD $) Albania (USD $) Algeria (USD $) Andorra (USD $) Angola (USD $) Anguilla (USD $) Antigua & Barbuda (USD $) Argentina (USD $) Armenia (USD $) Aruba (USD $) Ascension Island (USD $) Australia (USD $) Austria (USD $) Azerbaijan (USD $) Bahamas (USD $) Bahrain (USD $) Bangladesh (USD $) Barbados (USD $) Belarus (USD $) Belgium (USD $) Belize (USD $) Benin (USD $) Bermuda (USD $) Bhutan (USD $) Bolivia (USD $) Bosnia & Herzegovina (USD $) Botswana (USD $) Brazil (USD $) British Indian Ocean Territory (USD $) British Virgin Islands (USD $) Brunei (USD $) Bulgaria (USD $) Burkina Faso (USD $) Burundi (USD $) Cambodia (USD $) Cameroon (USD $) Canada (USD $) Cape Verde (USD $) Caribbean Netherlands (USD $) Cayman Islands (USD $) Central African Republic (USD $) Chad (USD $) Chile (USD $) China (USD $) Christmas Island (USD $) Cocos (Keeling) Islands (USD $) Colombia (USD $) Comoros (USD $) Congo - Brazzaville (USD $) Congo - Kinshasa (USD $) Cook Islands (USD $) Costa Rica (USD $) Côte d’Ivoire (USD $) Croatia (USD $) Curaçao (USD $) Cyprus (USD $) Czechia (USD $) Denmark (USD $) Djibouti (USD $) Dominica (USD $) Dominican Republic (USD $) Ecuador (USD $) Egypt (USD $) El Salvador (USD $) Equatorial Guinea (USD $) Eritrea (USD $) Estonia (USD $) Eswatini (USD $) Ethiopia (USD $) Falkland Islands (USD $) Faroe Islands (USD $) Fiji (USD $) Finland (USD $) France (USD $) French Guiana (USD $) French Polynesia (USD $) French Southern Territories (USD $) Gabon (USD $) Gambia (USD $) Georgia (USD $) Germany (USD $) Ghana (USD $) Gibraltar (USD $) Greece (USD $) Greenland (USD $) Grenada (USD $) Guadeloupe (USD $) Guatemala (USD $) Guernsey (USD $) Guinea (USD $) Guinea-Bissau (USD $) Guyana (USD $) Haiti (USD $) Honduras (USD $) Hong Kong SAR (USD $) Hungary (USD $) Iceland (USD $) India (USD $) Indonesia (USD $) Iraq (USD $) Ireland (USD $) Isle of Man (USD $) Israel (USD $) Italy (USD $) Jamaica (USD $) Japan (USD $) Jersey (USD $) Jordan (USD $) Kazakhstan (USD $) Kenya (USD $) Kiribati (USD $) Kosovo (USD $) Kuwait (USD $) Kyrgyzstan (USD $) Laos (USD $) Latvia (USD $) Lebanon (USD $) Lesotho (USD $) Liberia (USD $) Libya (USD $) Liechtenstein (USD $) Lithuania (USD $) Luxembourg (USD $) Macao SAR (USD $) Madagascar (USD $) Malawi (USD $) Malaysia (USD $) Maldives (USD $) Mali (USD $) Malta (USD $) Martinique (USD $) Mauritania (USD $) Mauritius (USD $) Mayotte (USD $) Mexico (USD $) Moldova (USD $) Monaco (USD $) Mongolia (USD $) Montenegro (USD $) Montserrat (USD $) Morocco (USD $) Mozambique (USD $) Myanmar (Burma) (USD $) Namibia (USD $) Nauru (USD $) Nepal (USD $) Netherlands (USD $) New Caledonia (USD $) New Zealand (USD $) Nicaragua (USD $) Niger (USD $) Nigeria (USD $) Niue (USD $) Norfolk Island (USD $) North Macedonia (USD $) Norway (USD $) Oman (USD $) Pakistan (USD $) Palestinian Territories (USD $) Panama (USD $) Papua New Guinea (USD $) Paraguay (USD $) Peru (USD $) Philippines (USD $) Pitcairn Islands (USD $) Poland (USD $) Portugal (USD $) Qatar (USD $) Réunion (USD $) Romania (USD $) Russia (USD $) Rwanda (USD $) Samoa (USD $) San Marino (USD $) São Tomé & Príncipe (USD $) Saudi Arabia (USD $) Senegal (USD $) Serbia (USD $) Seychelles (USD $) Sierra Leone (USD $) Singapore (USD $) Sint Maarten (USD $) Slovakia (USD $) Slovenia (USD $) Solomon Islands (USD $) Somalia (USD $) South Africa (USD $) South Georgia & South Sandwich Islands (USD $) South Korea (USD $) South Sudan (USD $) Spain (USD $) Sri Lanka (USD $) St. Barthélemy (USD $) St. Helena (USD $) St. Kitts & Nevis (USD $) St. Lucia (USD $) St. Martin (USD $) St. Pierre & Miquelon (USD $) St. Vincent & Grenadines (USD $) Sudan (USD $) Suriname (USD $) Svalbard & Jan Mayen (USD $) Sweden (USD $) Switzerland (USD $) Taiwan (USD $) Tajikistan (USD $) Tanzania (USD $) Thailand (USD $) Timor-Leste (USD $) Togo (USD $) Tokelau (USD $) Tonga (USD $) Trinidad & Tobago (USD $) Tristan da Cunha (USD $) Tunisia (USD $) Turkey (USD $) Turkmenistan (USD $) Turks & Caicos Islands (USD $) Tuvalu (USD $) U.S. Outlying Islands (USD $) Uganda (USD $) Ukraine (USD $) United Arab Emirates (USD $) United Kingdom (USD $) United States (USD $) Uruguay (USD $) Uzbekistan (USD $) Vanuatu (USD $) Vatican City (USD $) Venezuela (USD $) Vietnam (USD $) Wallis & Futuna (USD $) Western Sahara (USD $) Yemen (USD $) Zambia (USD $) Zimbabwe (USD $) © 2022 Certified Alarm Distributors We Accept American Express Apple Pay Diners Club Discover Meta Pay Google Pay Mastercard Shop Pay Visa © 2022 Certified Alarm Distributors Opens in a new window. | negative |
Minister for Transport Shane Ross has failed to fill 35 vacancies on State boards since taking office.
The figures were released from the Department of Transport, Tourism and Sport to Fianna Fáil TD Robert Troy.
They show two vacancies on the board of the Road Safety Authority since the start of September.
Three members need to be replaced on Iarnród Éireann’s board and four on the Taxi Advisory Committee.
Mr Ross has not made any appointments since becoming Minister in May, though he has renewed 16 contracts.
However, Mr Troy claimed the Minister had become “paralysed by his own indecision”.
“This shows how detached the Minister is from his responsibilities as Minister for Transport, Tourism and Sport,” he said.
“I would have concerns in particular with the vacancies with the Road Safety Authority.
“People are now questioning whether he is compromising the work of the board, and I think he should come out and say why he is not filling the gaps that exist.”
There are 25 boards under Mr Ross’s remit, including the RSA, Dublin Bus, Fáilte Ireland and Bus Éireann.
The figures released show voids on 16 of those.
Vacancies on the boards of the Dublin Airport Authority, the Irish Airport Authority and the Shannon Group have been unfilled since May.
The biggest gap is in the New Ross Port Company, which has five vacancies. Galway Port Harbour has four and three exist on the Transport Infrastructure Ireland board.
Appointment concerns
In response to a recent parliamentary question, Mr Ross did confirm that he had some concerns about the manner in which board members were chosen.
The Minister said he was considering how the appointment processes can be enhanced to ensure “in so far as possible, the best appointments are made to these Boards”.
The Department of Public Expenditure and Reform has issued guidelines on State board appointments.
Under these guidelines, the Public Appointments Service (PAS) advertises vacancies on the State Boards portal. Assessment panels are used to examine all applications and test their suitability.
Each Government department is then notified of all candidates that meet the advertised criteria. Where a reappointment is proposed, the PAS process does not apply.
Fianna Fáil said it was time for the Minister to outline his difficulties with the Public Appointment Service and how he intends to act on them.
“Now, I know he finds it hard to make decisions,” Mr Troy said.
“But that is the responsibility he has been charged with. It is time to step up to the plate and fulfil the duties he was tasked with.”
Qualifying committee
While an opposition TD, Mr Ross raised similar issues around the PAS and called for an independent commission to approve appointments.
He has said those who fill boards should be asked to appear before an Oireachtas committee to determine whether they are qualified.
The Dublin-Rathdown TD said Dáil committees would vote on their appointments and that an applicant must have two-thirds of the vote before their position could be ratified.
He also called for the number of semi-state bodies and agencies to be reduced significantly.
The Minister chose not to use the PAS when appointing a new chief executive for Fáilte Ireland.
Instead, he is using a private recruitment company, Amrop, in the search to replace Shaun Quinn, whose term ends in December.
The decision has been strongly criticised by Labour TD Alan Kelly. | positive |
Apple-Pine: Short Days of Winter Sketching, Illustration, Design and Everyday Life. Copyright by © Nina Khashchina except where noted. Short Days of Winter Shorter days usually means more time to play and read - but somehow there is never enough time... Email ThisBlogThis!Share to TwitterShare to FacebookShare to Pinterest No comments: Post a Comment Newer Post Older Post Home Subscribe to: Post Comments (Atom) About Nina Khashchina: I draw everywhere, I draw every day. Design, illustration, sketchbooking. Gouache, ink, watercolor, sketching underwater. Portfolio: Apple-Pine.com Featured Post War in Ukraine: Guide Through Posts on this Blog. War in Ukraine. There are many posts connected to this subject on my blog these days and this is a hub to organize different subjects connec... Subscribe to updates Email Address Categories Click To Choose a Category 30 days project (5) badger log (455) Gouache (115) project (53) scuba diving with a sketchbook (17) treasures (271) war (61) Search This Blog My Etsy Store: Originals, Prints, Books: My Badger Book! Scuba Diving with a Sketchbook Popular Posts Fixing Faber Castell Pitt Artist Pens! Inspired by one of the posts I found on a new blog by Roz , I decided to give a little kick to a couple of dying Faber Castell Pitt Artist ... Layers in my sketchbooks: Part 1 - How it Started and Why I started adding layers in my sketchbooks a few years ago when I realized two things: One is that I like my sketchbooks to be an honest refl... Refilling my tombow fudenosuke brush pen. I've been using tombow fudenosuke for some time now - it's a great workhorse - easy on any paper and with a varied line width and ... On My Table: First Day of July 2022. I just returned from a trip - and my table is a total mess as I am: trying to sort what in my travel kit was useful and what was not (two T... My personal tips and tricks to stay sane on instagram There is a lot to say about algorithms and social media but I will not go into the vortex of sharing my opinions. I will share some things t... Blog Archive ► 2022 (146) ► September 2022 (15) ► August 2022 (20) ► July 2022 (14) ► June 2022 (15) ► May 2022 (19) ► April 2022 (18) ► March 2022 (21) ► February 2022 (12) ► January 2022 (12) ► 2021 (87) ► December 2021 (14) ► November 2021 (16) ► October 2021 (17) ► September 2021 (5) ► August 2021 (5) ► May 2021 (3) ► April 2021 (3) ► March 2021 (9) ► February 2021 (8) ► January 2021 (7) ► 2020 (73) ► December 2020 (6) ► November 2020 (4) ► October 2020 (14) ► September 2020 (8) ► August 2020 (6) ► July 2020 (1) ► June 2020 (5) ► May 2020 (4) ► April 2020 (5) ► March 2020 (9) ► February 2020 (5) ► January 2020 (6) ► 2019 (33) ► November 2019 (5) ► October 2019 (4) ► September 2019 (3) ► August 2019 (3) ► July 2019 (3) ► May 2019 (3) ► April 2019 (2) ► March 2019 (2) ► February 2019 (2) ► January 2019 (6) ► 2018 (158) ► December 2018 (5) ► November 2018 (7) ► October 2018 (19) ► September 2018 (14) ► August 2018 (6) ► July 2018 (8) ► June 2018 (10) ► May 2018 (15) ► April 2018 (10) ► March 2018 (18) ► February 2018 (23) ► January 2018 (23) ► 2017 (285) ► December 2017 (48) ► November 2017 (19) ► October 2017 (16) ► September 2017 (33) ► August 2017 (23) ► July 2017 (18) ► June 2017 (25) ► May 2017 (12) ► April 2017 (22) ► March 2017 (27) ► February 2017 (23) ► January 2017 (19) ► 2016 (361) ► December 2016 (20) ► November 2016 (32) ► October 2016 (53) ► September 2016 (30) ► August 2016 (28) ► July 2016 (17) ► June 2016 (31) ► May 2016 (33) ► April 2016 (25) ► March 2016 (35) ► February 2016 (24) ► January 2016 (33) ► 2015 (325) ► December 2015 (28) ► November 2015 (26) ► October 2015 (55) ► September 2015 (50) ► August 2015 (38) ► July 2015 (35) ► June 2015 (41) ► May 2015 (21) ► April 2015 (11) ► March 2015 (6) ► February 2015 (3) ► January 2015 (11) ► 2014 (268) ► December 2014 (12) ► November 2014 (25) ► October 2014 (16) ► September 2014 (18) ► August 2014 (21) ► July 2014 (15) ► June 2014 (25) ► May 2014 (21) ► April 2014 (21) ► March 2014 (22) ► February 2014 (34) ► January 2014 (38) ► 2013 (275) ► December 2013 (42) ► November 2013 (47) ► October 2013 (29) ► September 2013 (38) ► August 2013 (13) ► July 2013 (22) ► June 2013 (13) ► May 2013 (11) ► April 2013 (13) ► March 2013 (15) ► February 2013 (17) ► January 2013 (15) ▼ 2012 (180) ▼ December 2012 (12) December 2012: Daily Flowers December 2012: Trip to NY - The City American Museum of Natural History Trip to NY - Train Show in The New York Botanical ... November 2012: Sketching while waiting. Lunch Short Days of Winter My Life Drawing Classes November 2012: Hiking Month :) Thanksgiving 2012 Bronx Zoo: red pandas American Museum of Natural History ► November 2012 (18) ► October 2012 (10) ► September 2012 (14) ► August 2012 (9) ► July 2012 (10) ► June 2012 (9) ► May 2012 (18) ► April 2012 (19) ► March 2012 (17) ► February 2012 (23) ► January 2012 (21) ► 2011 (133) ► December 2011 (10) ► November 2011 (21) ► October 2011 (15) ► September 2011 (11) ► August 2011 (12) ► July 2011 (15) ► June 2011 (5) ► May 2011 (12) ► April 2011 (5) ► March 2011 (6) ► February 2011 (7) ► January 2011 (14) ► 2010 (113) ► December 2010 (15) ► November 2010 (10) ► October 2010 (9) ► September 2010 (10) ► August 2010 (15) ► June 2010 (6) ► May 2010 (7) ► April 2010 (11) ► March 2010 (11) ► February 2010 (10) ► January 2010 (9) ► 2009 (226) ► December 2009 (9) ► November 2009 (17) ► October 2009 (12) ► September 2009 (17) ► August 2009 (19) ► July 2009 (17) ► June 2009 (28) ► May 2009 (17) ► April 2009 (23) ► March 2009 (26) ► February 2009 (22) ► January 2009 (19) ► 2008 (157) ► December 2008 (20) ► November 2008 (13) ► October 2008 (18) ► September 2008 (10) ► August 2008 (18) ► July 2008 (21) ► June 2008 (15) ► May 2008 (2) ► April 2008 (4) ► March 2008 (12) ► February 2008 (9) ► January 2008 (15) ► 2007 (113) ► December 2007 (11) ► November 2007 (13) ► October 2007 (18) ► September 2007 (9) ► August 2007 (4) ► July 2007 (8) ► June 2007 (7) ► May 2007 (7) ► April 2007 (11) ► March 2007 (5) ► February 2007 (12) ► January 2007 (8) ► 2006 (51) ► December 2006 (4) ► November 2006 (5) ► October 2006 (4) ► September 2006 (4) ► August 2006 (5) ► July 2006 (4) ► June 2006 (4) ► May 2006 (3) ► April 2006 (6) ► March 2006 (4) ► February 2006 (4) ► January 2006 (4) ► 2005 (25) ► December 2005 (4) ► November 2005 (4) ► October 2005 (5) ► September 2005 (4) ► August 2005 (4) ► July 2005 (4) Tags badger log (455) badger (450) treasures (271) daily sketches (226) plein aire (179) people (176) parenting (141) everyday life (133) Gouache (115) reading (108) urban sketching (104) plants (97) travel (92) flowers (85) inktober (79) Ukraine (74) Tools (73) parents (73) cello (67) Illustration Friday (64) Sketchbook #94 (61) war (61) my life drawing class (60) people reading (59) food (58) Sketchbook #93 (54) project (53) Sketchbook #100 (50) leaves (49) tree (45) watercolor (45) people at work (44) taekwondo (44) black and white (40) drawing everywhere (40) music (37) reading time (37) Sketchbook #102 (36) Sketchbook #98 (36) people I met (36) persimmon (36) Bonaire (35) music class (34) Process (33) Sketchbook #109 (33) inktober2015 (33) Sunnyvale (32) Sketchbook #101 (31) inktober 2016 (31) suhita (31) drawing flowers (30) Sketchbook #104 (29) Sketchbook #88 (29) Sketchbook #92 (29) Sketchbook #99 (29) sketchbook #111 (29) sketchbook #112 (29) sketching underwater (29) sketching while scuba diving (29) On my table (28) life drawing (28) owls (27) owls project (27) Hidden Villa (26) Sketchbook #108 (26) mountain view (25) scuba diving (25) SF bay area (24) Sketchbook #107 (24) draw & travel (24) flower (23) sketchbook #114 (23) Sketchbook #103 (22) Sketchbook #91 (22) mini paintings (22) peony (22) scuba (22) tkd (22) underwater (22) owl (21) apple (20) birds (20) drawing your food (20) dry flowers (20) magnolia (20) mushrooms (20) sketchbook (20) sketchbook #79 (20) trees (20) Sketchbook #110 (19) Sketchbook #115 (19) Sketchbook #97 (19) ball point pen (19) iris (19) irises (19) sketching while waiting (19) swimming (19) 100 Views of Silicon Valley (18) 2017 (18) Sketchbook #105 (18) acorn (18) acorns (18) black belt training (17) drawing while waiting (17) lilies (17) painting flowers (17) scuba diving with a sketchbook (17) tiny gouaches (17) traveling (17) watercolor pencil (17) Sketchbook #90 (16) blooming tree (16) my news digest (16) practice (16) urban (16) 2012 (15) Workshop (15) ink and watercolor wash (15) seed pod (15) sketching (15) Books (14) Halloween (14) New York (14) Sketchbook #106 (14) Sketchbook #95 (14) animals (14) hyacinth (14) ink (14) oak (14) seasons (14) silicon valley (14) tiny gouache painting (14) tulips (14) video (14) 2013 (13) 30 gouaches (13) Caribbean (13) Christmas (13) March 2022 (13) adventure (13) california (13) food illustration (13) october (13) rite-in-the-rain paper (13) summer (13) April 2022 (12) Ballpointpen (12) agapanthus (12) dogs (12) fall (12) palette (12) sketching in nature (12) sketching tools (12) Alaska (11) San Francisco (11) Sketchbook #85 (11) apples (11) baylands (11) building (11) dog (11) hiking (11) portrait (11) running (11) sketchbook #80 (11) succulent (11) tea (11) Sketchbook #89 (10) Voices of the Wilderness (10) gouache palette (10) illustrated recipe (10) pineapple guava (10) sea shells (10) self-portrait (10) snow (10) succulent box (10) 2014 (9) 2018 (9) 30 tiny gouaches (9) Artist-In-Residence (9) May 2022 (9) Projects (9) Scotland (9) Sketchbook #113 (9) Sketchbook #96 (9) South Baranof Wilderness 2012 Voices of the Wilderness Artist-In-Residence Program (9) bonaire scuba diving 2016 (9) color (9) drawing underwater (9) eucalyptus (9) field trip (9) food tasting and sketching (9) friends (9) holiday (9) kitchen table (9) liquid watercolors (9) ocean (9) peonies (9) poppy (9) red (9) rocks (9) shoreline park (9) villa montalvo (9) watercolor palette (9) Maryland (8) Sitka (8) South Baranof (8) Trip to New York (May 2009) (8) change of seasons (8) color pencil (8) daffodil (8) drawing (8) grateful (8) lilac (8) point lobos (8) project based learning (8) seed (8) seeds (8) sketching people (8) wisteria (8) zoo (8) Canyon (7) Gay Kraeger (7) Pacific Ocean (7) Portrait Party (7) Quarantine (7) Sketchbook #84 (7) balcony garden (7) book (7) dog portraits (7) fitness (7) forest (7) gouache workshop (7) inktober 2020 (7) israel (7) orange (7) palo alto (7) pigs (7) pine cone (7) school (7) show your work (7) skiing (7) skiing and sketching (7) tooth (7) trees-choices (7) waterfall (7) Amsterdam (6) Austria (6) Europe (6) Handmade Journals (6) Matilija Poppy (6) Sketchbook #28 (6) Stanford (6) alum rock park (6) beach (6) chestnut (6) drawing challenge (6) drawing exercises (6) flip through (6) freesia (6) gardening (6) jacaranda (6) kicking (6) kirkwood (6) leaf (6) mushroom forest (6) octogenarian (6) pencil (6) presents (6) recipe (6) sketch (6) snow sketching (6) spring (6) stretching (6) tea time (6) tulip tree (6) window (6) winter trees (6) yosemite (6) "Gay Kraeger" (5) 30 days project (5) Adirondacks (5) Arizona (5) August 2022 (5) Hawaii (5) July 2022 (5) Kharkov (5) Library (5) Mendocino (5) New York-Ukraine-NewYork May 2017 (5) Sketchbook #87 (5) Tahoe (5) airplane (5) buddha hand (5) candle (5) december (5) exercises (5) fucsia (5) google building (5) hakone gardens (5) hands (5) hydrangea (5) inktober2021 (5) learning (5) narcissus (5) pen (5) pen and ink (5) pine (5) pink (5) prismacolor pencil (5) real life (5) roatan (5) sketchbook process (5) sticks (5) tree cutters (5) winter (5) 10x10 (4) Banff (4) Canada (4) Chrysanthemum (4) Los Altos (4) New Year (4) Prague (4) Running and sketching (4) Sketchingwhilewaiting (4) Sunol (4) airport (4) annotated sketches (4) attitude (4) autumn (4) bouquet (4) browns (4) bulbs (4) calendar (4) class (4) concert (4) doctor's office (4) drawing with kids (4) eagle ray (4) end of the year (4) event (4) experiment (4) game (4) google (4) gouache sketchbook (4) haircut (4) highlighters (4) honduras (4) identification (4) illustrated (4) illustration (4) instagram (4) kayaking (4) lemon (4) materials (4) museum (4) new sketchbook (4) painting (4) pineapple (4) pocket sketchbook (4) pumpkin (4) sketching trio (4) sketchingeverywhere (4) squirrel (4) strawflowers (4) teaching (4) tips and tricks (4) travel sketching (4) trick (4) urban naturalist (4) usk (4) Dentist Check-Up (3) June 2022 (3) Monsters (3) September 2022 (3) Sketchbook #86 (3) The Cat With No Name (3) Utah (3) Wunderlich Park (3) araucaria (3) banana (3) bark (3) blogging (3) book launch (3) book reading (3) bottle tree (3) bread (3) brushpen (3) cabin (3) california poppy (3) calla (3) canals (3) carrot (3) carrots (3) cats (3) christmas ornament (3) citrus (3) collection (3) colors (3) conversation (3) coronavirus (3) drawing in a museum (3) drum fish (3) everyday matters (3) family (3) farmers market (3) friendship (3) hammershoi (3) homework (3) house (3) humming bird (3) key (3) las palmas park (3) lassen volcanic (3) layers (3) markers (3) mixed media sketchbook (3) morning (3) naming things (3) nature (3) night (3) nonagenarian (3) orchard (3) parenthood (3) parsley (3) photo (3) picchetti ranch (3) piglets (3) poet (3) portraits (3) present (3) pumpkins (3) purple (3) purple pen (3) rain (3) redwood (3) results (3) river (3) san jose (3) saratoga (3) school orchestra (3) sea lavender (3) sea ranch (3) seagulls (3) sf zoo (3) sketch kit (3) sketchbook cover (3) sketchbook evolution (3) sketchbook spreads (3) sketching game (3) sketchnotes (3) sleep (3) sleeping (3) sparring (3) spatter (3) sunset (3) tai chi (3) the pig who danced (3) time (3) turtle (3) university (3) vegetables (3) "airport day" (2) "art digestion" "tom Thomson" "re-created art" (2) 20 brushstrokes (2) 2011 (2) 30x30DirectWatercolor2018 (2) 4th of July (2) Alstroemeria (2) Antelope (2) Art Museum (2) Artist in Residence (2) Blind Contour (2) Blue heron (2) CalAcademy (2) Creatures (2) De Young (2) Egyptian Museum (2) February 2022 (2) Los Gatos (2) Netherlands (2) Oleander (2) Santa Cruz mountains (2) September (2) Sketchbook at a glance (2) The Diversity King (2) USS Hornet (2) Vltava (2) Week in review (2) Zion (2) acacia (2) accordion sketchbook (2) ackerman (2) advice (2) art hero (2) atlantic squid (2) baking (2) barcelona (2) basil (2) beets (2) big leaf maple (2) bike (2) biking and sketching (2) bird (2) blooming (2) blue vase (2) boot (2) botanical (2) branches (2) bridge (2) brush pen (2) cabbage (2) cactus (2) cars (2) caterpillar (2) challenge (2) channel islands (2) children's book (2) chinese elm (2) city (2) cleaning table (2) clementine (2) cone (2) construction site (2) corals (2) costumes (2) coyote hills (2) crab (2) creamery (2) crocodile (2) cuties (2) cyclamen (2) day (2) decorations (2) drawing daily (2) drink (2) early morning (2) eclipse (2) elf (2) emer martin (2) excellent (2) excited (2) field notes (2) fig (2) fire (2) flying (2) food tasting (2) found objects (2) fruits (2) fuchsia (2) garin park (2) geese (2) geranium (2) gifts (2) good (2) good story (2) grayscale (2) green heron (2) guests (2) guide (2) happy (2) herons (2) hyrax (2) inktober 2017 (2) inktober2016 (2) instrument (2) jump-squats (2) kayak (2) koh-i-nor multipencil (2) lavender (2) learning a language (2) lesson (2) lichen (2) log (2) look (2) map (2) marigolds (2) measuring (2) measuring time (2) meeting (2) memory drawing (2) mitchell park (2) mom (2) monet (2) moss (2) my heroes (2) names (2) naturalist (2) nuts (2) onion (2) opal apple (2) oregano (2) organizing (2) ornament (2) paint markers (2) palm tree (2) paper (2) paper towels (2) pear (2) pilot parallel pen (2) plaid blanket (2) plan (2) planst (2) play (2) plum (2) pockets (2) pod (2) pomegranate (2) potato (2) preserve (2) protea (2) public library (2) publication (2) pumpkin patch (2) purple leaf plum tree (2) raining (2) rally (2) redwood forest (2) reportage (2) review (2) romneya (2) salt (2) santa cruz (2) saratoga public library (2) sea (2) seashells (2) security (2) security envelope (2) shadows (2) shells (2) shoe horn (2) shore (2) sketching with scissors (2) sketchnoting (2) sleeping people (2) sleepy (2) song (2) soup (2) spain (2) spider (2) spoon (2) sport (2) sprint (2) stickers (2) story (2) strawberries (2) talking people (2) thanksgiving (2) time-lapse (2) tiny (2) tolerance (2) tomatoes (2) toned paper (2) traditions (2) traffic sketch (2) training (2) trumpet (2) volcano (2) watermelon (2) weather (2) wishes (2) workspace (2) yellow (2) zinnias (2) "Artists' Journal Workshop" (1) "I am it" (1) "pass the journal" (1) 00 Views of Silicon Valley (1) 100 (1) 100 people (1) 2018NestNine (1) 30x30directwatercolor (1) 9to5mac (1) Academy of Sciences (1) Alameda (1) Alice neel (1) Anteater (1) Antelope Canyon (1) Anthriscus sylvestris (1) April 2022 (1) Aquarium (1) Asian Art Museum (1) Bernal Heights (1) Big Island (1) Bodie town (1) Bryce (1) Bryce Canyon (1) C.J. Olson (1) Capoeira (1) Cathy Johnson (1) Centre for Transformative Work Design (1) Chamber of Commerce (1) Chinchilla (1) Colorado River (1) Construction (1) Cover (1) Cubberley Community Center (1) Eggplant (1) El Camino Real (1) El Paseo de los Suenos (1) Eschscholzia californica (1) Fiji 2010 (1) GYM (1) Geninne (1) Germany (1) Great Canyon plein aire (1) Great Horned Owl (1) Haarlem (1) Hals (1) Hangar One (1) Horseshoe Bend (1) Interview (1) Keukenhof (1) Loma Prieta (1) Mary Oliver (1) Mathilda (1) Monterey (1) Mustard Fields (1) NASA (1) Newsletter (1) Northern pygmy owl (1) November (1) Picasso (1) RIP (1) Redwood City (1) Rockwell (1) SFO (1) SJSU (1) Salzburg (1) San Francisco Bay Area (1) Sierras (1) Sketchbook #58 (1) Sketchbook #77 (1) Sketchbook #78 (1) Sketchbook #82 (1) Sketchbook #83 (1) Sketchbook 143 (1) Strathmore (1) The Sierra Club (1) Thoreau (1) Turbo (1) Verreaux's (1) Verreaux's eagle-owl (1) Vienna (1) Virginia City (1) Wisława Szymborska (1) afraid (1) african tulip tree (1) airedale (1) akko (1) alphabet (1) amaryllis (1) angel fish (1) anticipation (1) antique (1) anything (1) apple park (1) apple park visitor center (1) apple-pine (1) architecture (1) art studio (1) astronomy (1) aubergine (1) australian (1) australian shepherd (1) avocado (1) awesome (1) axolotl (1) badger year 2012 (1) banyan tree (1) barn owl (1) barnacle (1) barred owl (1) basketball (1) bats (1) bay lands (1) beach combing (1) bear crawl (1) bee (1) believe (1) bell pepper (1) berenjena (1) bergman (1) bestnine (1) bic (1) bicycle (1) biker (1) biking (1) black (1) black hole (1) blakinston's (1) blakinston's owl (1) bleed (1) blinds (1) blood (1) blood orange (1) bloom (1) blue (1) board (1) boat (1) bol park (1) boreal (1) boreal owl (1) botanical garden (1) bougainvillea (1) bow river (1) braces (1) bridges (1) broom (1) brown fish (1) brown fish owl (1) brush (1) buddy push-ups (1) buildings (1) bunya pine (1) burrowing owl (1) canadian bunchberries (1) candied fruit (1) candy (1) canna (1) carpenter bee (1) cave (1) celery (1) celling (1) cemetery (1) chair (1) chalk (1) cherry orchard (1) chertovka (1) chess (1) chicken (1) chickens (1) chinstrap (1) choice (1) choices (1) church (1) clouds (1) coconut (1) coin (1) collections (1) color paper (1) come on (1) company (1) competition (1) concertina (1) concertina sketchbook (1) cooking (1) cottontail (1) covid-19 vaccine (1) cow parsley (1) creek (1) crested (1) crested owl (1) crows (1) cucumbers (1) cupertino (1) curious (1) curly (1) curly brace (1) czech republic (1) d (1) dahlias (1) data (1) data drawing (1) dead sea (1) devil's postpile (1) different (1) dinosaur (1) disaster (1) dissecting (1) distillery (1) diving (1) dogwood (1) dome of the rock (1) done (1) door (1) doubt (1) dragon (1) draw (1) drawing sketchbook (1) driftwood (1) dry cow parsley (1) ducks (1) edgewood park (1) eggs (1) eichler (1) eichler house (1) elephant (1) elf owl (1) elk (1) encouragement (1) endangered species (1) envelope (1) eraser (1) etsy shop (1) eurasian eagle (1) eurasian eagle-owl (1) eurasian scops owl (1) eyes (1) face id (1) failure (1) fast (1) feather (1) feet (1) fennel (1) field notes expedition notebook (1) fig tree (1) filoli gardens (1) finally (1) fire truck (1) fireweed (1) floor is made of lava (1) flower alphabet (1) flute (1) forms (1) fountain (1) fox (1) freckle pelt (1) free (1) frost (1) fruit (1) fudenosuke (1) fungi (1) gamla (1) gardens (1) gecko (1) german shepherd (1) gesso (1) gesture (1) getting things done (1) giant (1) giant eagle-owl (1) ginkgo (1) glacier (1) gladiolus (1) go! (1) goat (1) gold rush (1) google maps (1) google maps pin (1) gouache your world (1) grand canyon (1) grass (1) green (1) grid (1) grotto (1) growing (1) growing up (1) hahnemuhle (1) haifa (1) hair (1) hair dryer (1) handstand (1) hare (1) hat (1) head (1) headache (1) headphones (1) heart (1) hedgehog (1) helicopter (1) helmet (1) hen (1) herring (1) hide and seek (1) hike and sketch (1) hill (1) hippo (1) hippopotamus (1) historic (1) hope (1) hot (1) hot creek (1) hot pink (1) huge (1) hummingbird (1) hygge (1) i like it (1) ibex (1) ice cave (1) ice skating (1) incentive (1) infinity (1) infographics (1) inktober 2018 (1) inktober 2019 (1) inktober2017 (1) intermission (1) introduction (1) ipad (1) iphone (1) island-hopping (1) islands (1) jar (1) jewish quarter (1) journal (1) jump (1) june (1) kangaroo (1) kaylyn messer (1) kids (1) king (1) klimt (1) komodo (1) ladle (1) lake (1) lake louise (1) lakes (1) lamp (1) lantana (1) lava (1) learning spanish with a sketchbook (1) lego (1) lemur (1) let's (1) light (1) lights (1) limonium (1) linden (1) list (1) listening (1) live illustration (1) liz steel (1) lizards (1) long day (1) long-eared owl (1) loosing (1) lost (1) lost things (1) lucia berlin (1) lunar (1) lunaria (1) lunchtime (1) madagascar (1) madagascar owl (1) magic (1) magnifying glass (1) making (1) mandarin (1) mangrove (1) mangrove forest (1) maple (1) maps (1) maria popova (1) marine preserve (1) market (1) marmot (1) mason jar (1) match (1) mediterranean (1) mess (1) meteor (1) mexican wolf (1) microscope (1) milky (1) milky eagle-owl (1) mind map (1) money (1) moomins (1) moon (1) moose (1) moth (1) mother's day (1) motivation (1) mountains (1) mouse (1) moving (1) muji (1) muji pens (1) multimedia (1) mums (1) mustard (1) national dogs day (1) national park (1) negative space (1) neighbor (1) night heron (1) night sketching (1) nodding onion (1) northern hawk (1) northern hawk owl (1) not far (1) not to worry (1) notebook (1) octopus (1) odds and ends (1) oil pastel (1) old keys (1) oops (1) orchestra (1) organization (1) oriental bay owl (1) package (1) paint (1) paint tubes (1) panda (1) pandemic (1) pants (1) paper cut sketches (1) parade (1) parcel (1) park (1) park guell (1) pastel (1) patio (1) peach (1) pear tasting (1) pen maintenance (1) penguin (1) performance (1) personal (1) petals (1) philippine owl (1) picture (1) pierce 66 (1) pilaf (1) pincers (1) pine nuts (1) pinky (1) pinnacles national monument (1) plank (1) plans (1) platan (1) playground (1) please (1) pochade box (1) pods (1) poem (1) police station (1) polish (1) pool (1) portulaca (1) poses (1) poster (1) powerful (1) powerful owl (1) powwow (1) preliminary testing (1) promise (1) punching (1) pygmy (1) qechet cave (1) quiet (1) quilting people (1) rabbit (1) race (1) radish (1) rainbow falls (1) rainbow maker (1) rainbow pencil (1) raisins (1) rama hughes (1) reasons (1) recorder (1) red panda (1) red tailed hawk (1) refilling (1) relationships (1) reminder (1) resketch (1) rice (1) ronald searle (1) room (1) rubber band (1) rule (1) rules (1) salad (1) salt flats (1) salt mine (1) salt mountains (1) salt pans (1) salt pyramids (1) sand crab (1) saw-whet (1) saw-whet owl (1) science project (1) scissors (1) scops (1) screech (1) screech owl (1) sculpey (1) sea acorns (1) sea oatters (1) sea urchin (1) seaweed (1) secret (1) sheep's heart (1) shepherd (1) shirt (1) short (1) short eared owl (1) silently (1) silhouette (1) silly (1) singing (1) skate (1) skateboard (1) skating (1) sketchbook #127 (1) sketchbook #54 (1) sketchbook #60 (1) sketchbook #61 (1) sketchbook #63 (1) sketchbook archive (1) sketchbook gallery (1) sketchbook review (1) sketchbook rituals (1) sketchbook tour (1) sketching in a kayak (1) sketching sleeping people (1) sketching while boating (1) sky (1) sloth (1) small (1) snail (1) snake (1) snapshot (1) snow flake (1) snowflakes (1) snowshoeing (1) snowy owl (1) socks (1) solar (1) solar eclipse (1) sound (1) spanish (1) spectacled owl (1) spot-bellied eagle owl (1) spring cleaning (1) stabilo woody pencils (1) statue (1) stencils (1) still life (1) stone (1) streamline (1) street (1) sunflowers (1) swan (1) sycamore tree (1) sylvan park (1) symphony (1) system (1) t-rex (1) tapir (1) tea pot (1) teardrop (1) terrier (1) texture (1) the joy (1) the joy of gouache (1) theory (1) theory for everything (1) thumbnails (1) thundercloud plum tree (1) thyme (1) tickle (1) ticklish (1) tilia tree (1) tim ferriss (1) timer (1) tired (1) tombow (1) touch (1) tour guide (1) tradescantia (1) trash (1) treasure (1) tree branches (1) tree choices (1) tree rings (1) trust (1) truth (1) try (1) turkey (1) turquoise (1) twit (1) underwater drawing tools (1) unedited (1) uni pen (1) uniform (1) uniq fruit (1) urchin (1) vacation (1) valentine (1) vegetable (1) vermeer (1) virtual travel (1) vyshyvanka (1) washi tape (1) watercolors (1) waterfront (1) watering (1) wb-site update (1) web-site update (1) weekend (1) wetlands (1) what I eat during winter (1) what is in my pockets (1) when stuck (1) who me? (1) wilderness (1) wishful drawing (1) wolf (1) wombat (1) work pants (1) work shirt (1) worry (1) worst (1) wrinkles (1) writing (1) wrong way (1) zine (1) баклажан (1) синенький (1) цукат (1) Powered by Blogger. | negative |
Kbc Ghar Baithe Jeeto Jackpot 2023 | KBC Sim Card Lucky Draw 2023 Skip to content Menu Close WHATSAPP: 19188030555 Search for: Menu KBC Sim Card Lucky Draw About Contact Blog Kbc Lottery Number Check Online 2022 Kaun Banega Crorepati Registration 2022 Kbc Ghar Baithe Jeeto Jackpot 2023 Kbc Lottery Winner 2023 25 Lakh List Today All India KBC Sim Card Lucky Draw 2023 KBC All India Sim Card Lucky Draw 2023 KBC All India Sim Card Whatsapp Imo Lucky Draw 2023 KBC Sim Card Lucky Draw WhatsApp Winner List 2022 KBC Sim Card Lucky Draw 2023 Airtel KBC Sim Card Lucky Draw 2023 IMO Welcome to Consulting. Search for: KBC Sim Card Lucky Draw About Contact Blog Kbc Lottery Number Check Online 2022 Kaun Banega Crorepati Registration 2022 Kbc Ghar Baithe Jeeto Jackpot 2023 Kbc Lottery Winner 2023 25 Lakh List Today All India KBC Sim Card Lucky Draw 2023 KBC All India Sim Card Lucky Draw 2023 KBC All India Sim Card Whatsapp Imo Lucky Draw 2023 KBC Sim Card Lucky Draw WhatsApp Winner List 2022 KBC Sim Card Lucky Draw 2023 Airtel KBC Sim Card Lucky Draw 2023 IMO WHATSAPP: 19188030555 Kbc Ghar Baithe Jeeto Jackpot 2023 KBC Sim Card Lucky Draw 2023 Kbc Ghar Baithe Jeeto Jackpot 2023 KBC Sim Card Lucky Draw 2023 Sim Card Lucky Draw Competition Kbc Winner List 2023,Kbc Sim Card Lucky Draw 2023 Winners List Airtel,Sim Card Lucky Draw Competition Kbc Winner List,All Indian Sim Card Whatsapp Imo Lucky Draw,Kbc Sim Card Lucky Draw 2023 Winners List,Kbc Sim Card Lucky Draw 2023 Winners List,Kbc Sim Card Lucky Draw Competition 2023,Kbc Sim Card Lucky Draw Competition 2023 KBC Latest Posts 2023 KBC Popular Searches 2023 Kbc Lottery Number Check Online 2022 Kbc Lottery Winner 2023 25 Lakh List Today Kbc Ghar Baithe Jeeto Jackpot 2023 Kaun Banega Crorepati Registration 2022 KBC Contact Number 2023 Jio Kbc Head Office Number 2023 +19188030555 Kbc Whatsapp Number 2023 Kbc Helpline Number 2023 +19188030555 Kbc Head Office Whatsapp Number 2023 +19188030555 Kaun Banega Crorepati Main Head Office Contact Number 2023 Kbc Lottery Head Office Number 2023 +19188030555 Popular Searches About: Jio Kbc Head Office Number About | Kbc Jio Lottery Winner Official Website: Kbc Head Office Number Mumbai +19188030555 Kbc Head Office Number Kolkata +19188030555 Kbc Head Office Number Delhi +19188030555 Kbc Head Office Number 2023 Kbc Whatsapp Head Office Number 2023 Kaun Banega Crorepat, – Kbc Head Office Number 2023: Kbc Head Office Whatsapp Number Mumbai Kbc Head Office Toll Free Number Online. Kbc Lucky Lottery Winner Head Office Kolkata, Delhi, Mumbai All India Kbc Sim Cards Lucky Lottery Competition 2023 Kbc Lucky Lottery Head Office Mumbai 2023 Kbc Head Office Number Delhi 2023. Kbc Contact Number 2023 Kbc Whatsapp Number 2023 Kbc Head Office Number 2023 Kbc Lottery Winner 2023 Kbc Whatsapp Number 2023 Kbc Helpline 2023 Jio Kbc Lottery Winner 2023 List Copyright © 2022 KBC Sim Card Lucky Daraw 2023 KBC Live Call | negative |
Have you ever watched an amazing TED talk and concluded: ‘I’m going to change my behavior!’ Perhaps you wanted to procrastinate less, show your vulnerability more, pay attention to your body language, focus on your happiness instead of success. These are just of few topics covered in the most popular Ted talks of all time. Yet, several days later you realize that you haven’t actually put the idea into practice?
The Power Of Motivation
With over 4 million subscribers on YouTube we can conclude that TED talks are pretty popular. The speakers share their insight on many different fascinating phenomena in the world. Many talks cover topics related to personal growth. Apparently, we like learning about how we can become happier, how we become our most fulfilled selves and how we can change our life.
Yet, how many of us actually put these ideas into practice?
“Very few, if any” says Tom Asacker in his fascinating TED talk. “I don’t get enough sleep, I still use too many paper towels and I still buy bottled water” he says.
Why We Don’t Do What We Want To Do
Why is that? Why don’t we do what we know we SHOULD do? Are we not capable?
Most of the time we are perfectly capable. We are even willing. And sometimes we even know HOW we can achieve it. Yet, our motivation will not sustain long enough to actually accomplish it.
Our minds are dynamic systems, which are influenced by our changing perceptions and desires. We are FULLY motivated during and after listening to the speeches. But that paper towel seems quite handy when you want to dry your hands and buying a bottle of water sure is convenient.
You could conclude that humans are a bit lazy. Or weak. But that is a bit too simplistic. The crucial element in explaining our behavior is: intrinsic motivation. Behavior will not change when our intrinsic motivation does not match the message of the speech. Motivation will melt away quickly when it is extrinsically imposed on us through any kind of motivational talk.
Their Idea Versus Your Reality
So, can’t a motivational talk ever incite a behavioral change? It can. When our desire exactly matches the one of the speaker and when our perception of this desire is the same across different situations.
Go watch Tom Asacker’s captivating talk here! | positive |
California Lowers Penalty Tax for IRC §409A Violations - Teknos Associates Services Corporate Advisory Services Tax Compliance and Financial Reporting Valuation Services Litigation Support and Expert Witness Testimony Markets Information Technology Life Sciences and Biotechnology Alternative Energy and Cleantech Blockchain Technology and Digital Currency Esports and Gaming Other Emerging Growth Venture Capital and Private Equity Clients Testimonials Information Technology Blockchain Technology and Digital Currency Life Sciences and Biotechnology Alternative Technology and Cleantech Esports and Gaming Other Emerging Growth Team Insights Contact Menu Services Corporate Advisory Services Tax Compliance and Financial Reporting Valuation Services Litigation Support and Expert Witness Testimony Markets Information Technology Life Sciences and Biotechnology Alternative Energy and Cleantech Blockchain Technology and Digital Currency Esports and Gaming Other Emerging Growth Venture Capital and Private Equity Clients Testimonials Information Technology Blockchain Technology and Digital Currency Life Sciences and Biotechnology Alternative Technology and Cleantech Esports and Gaming Other Emerging Growth Team Insights Contact California Lowers Penalty Tax for IRC §409A Violations The California income tax law largely conforms to federal income tax law and California routinely uses the federal definitions of taxable income or tax deductions. This was true with the penalty surtax which applies to “nonqualified deferred compensation” under IRC §409A. In plain English, this includes taxation on gains from stock options which were underpriced (that is, options which were priced below the fair market value of common stock at the time of issuance). Federal law applied a surtax of 20% to such gains and California mirrored that with its own 20% surtax. Governor Jerry Brown signed AB 1173 which changed this surtax from 20% to 5% for taxable years beginning on or after January 1, 2013. While this seems like good news, it really only lowers the combined federal and state taxes on underpriced option gains from more than 90% to 75%.* Obviously, even 75% taxation is too high to take the risk of underpricing stock options and we recommend that companies comply with IRC §409A by obtaining an independent appraisal every 12 months (or less, if there is a material change) before issuing stock options. *Computed as follows: highest federal rate 39.6%, plus highest California rate 9.3% (ignoring the rate of 10.3% which applies to income above $1,000,000 for those filing as single or $2,000,000 for those filing as married) plus Medicare of 2.35% (ignoring Social Security of 6.2% on a wage base of up to $113,700), plus federal surtax of 20.0% and California surtax of 20.0% or 5.0%. Teknos Associates provides valuation and advisory services for emerging growth companies and their venture capital backers. Clients rely on our financial expertise, knowledge of technology markets, and high standards to deliver relevant and timely valuation reports and fairness opinions. Special Note: From time to time, Teknos Associates has been retained by the Internal Revenue Service to perform valuation services. However, nothing in this communication may be taken to represent the official position or policy of the IRS. The opinions expressed herein are those only of Teknos Associates. IRS Circular 230 Disclaimer: Pursuant to regulations governing the practice of attorneys, certified public accountants, enrolled agents, enrolled actuaries, and appraisers before the Internal Revenue Service, unless otherwise expressly stated, any U.S. federal or state tax advice in this communication (including attachments) is not intended or written to be used, and cannot be used, by a taxpayer for the purpose of (i) avoiding penalties that may be imposed under federal or state law or (ii) promoting, marketing, or recommending to another party any transaction or tax-related matter(s) addressed herein. Schedule a Call Book Now More Insights Commentary Coronavirus Impacts On The Investment Industry: What You Need To Know Coronavirus and 409A Valuations COVID-19, Esports, and Gaming The Streamer Wars: How Ninja’s Defection to Mixer Started the Bidding War The Rise of Female Gamers: Esports’ Underappreciated Fans All Commentary White Paper Valuing Customer Relationships – Misconceptions of the Distributor Method League of Branding A Quick Reminder About Fairness Opinions IRC § 1202 – Qualified Small Business Stock: For Some Investors, Some Serious Tax Savings Advisory Services – Modeling: ASC 606 Product Lives All White Papers Headquaters San Francisco, CA (650) 330-8800 [email protected] Locations Phoenix, AZ Portland. OR San Diego, CA Services Corporate Advisory Services Tax Compliance and Financial Reporting Valuation Services Litigation Support and Expert Witness Testimony Menu Corporate Advisory Services Tax Compliance and Financial Reporting Valuation Services Litigation Support and Expert Witness Testimony Markets Information Technology Blockchain Technology and Digital Currency Life Sciences and Biotechnology Alternative Technology and Cleantech Esports and Gaming Other Emerging Growth Menu Information Technology Blockchain Technology and Digital Currency Life Sciences and Biotechnology Alternative Technology and Cleantech Esports and Gaming Other Emerging Growth Who We Are Team Testimonials Insights Contact Menu Team Testimonials Insights Contact LinkedIn icon Copyright 2022 Teknos Associates. All Rights Reserved. Contact Us To Schedule A Free Consultation Submit | negative |
BANGKOK — Despite the assertions of two junta-appointed lawmakers, general elections will be held this year as promised by the regime, deputy junta chairman Prawit Wongsuwan said Thursday.
Dismissing suggestions Thailand would have to wait until mid-2018 for a vote, Gen. Prawit said the “roadmap” laid down by the junta to restoring democratic rule by the end of 2017 will not be changed.
Read: No Elections For Thailand This Year, NLA Says
“The roadmap is still the same,” said Prawit, who also serves as deputy prime minister. “It’s unchanged.”
Concerns of prolonged military rule were raised after two members of the National Legislative Assembly, Surachai liengboonlertchai and Somjet Boontanom, said there won’t be enough time to write required laws to organize an election this year.
Speaking to reporters Thursday, Prawit said Surachai and Somjet were merely speculating on their own.
It’s been more than five years since the last election in Thailand. A snap election in 2014 was boycotted by the opposition movement and later nullified by a court, resulting in a political vacuum that led to the military takeover in May that year.
The junta initially assured the public an election would be held in October 2015, but that and other dates have come and gone with 2017 being the regime’s most recent commitment.
Related stories:
Post-Coup Election May Be Delayed To 2016
Junta Promises Election in 2017, For Real This Time | positive |
A girl whose biological father does not live in her household has a higher chance of entering puberty earlier than her peers, say researchers from the University of California, Berkeley, in an article published in the Journal of Adolescent Health. The investigators report that the absence of a biological father in the household predicted earlier pubic hair and breast development - the association was only detected in higher income families.
Even after such factors as the girl's bodyweight were considered, the findings still held, the authors wrote.
Julianna Deardorff, UC Berkeley assistant professor of maternal and child health, and lead study author, said:
The age at which girls are reaching puberty has been trending downward in recent decades, but much of the attention has focused on increased body weight as the primary culprit. While overweight and obesity alter the timing of girls' puberty, those factors don't explain all of the variance in pubertal timing. The results from our study suggest that familial and contextual factors - independent of body mass index - have an important effect on girls' pubertal timing.
Although the main focus of the CYGNET Study is on environmental exposures, we are also keenly interested in the social and behavioral contexts in which maturation occurs. These findings demonstrate that such factors may play important roles in the onset of puberty in girls.
It's possible that in lower income families, it is more normative to rely upon a strong network of alternative caregivers. A more controversial hypothesis is that higher income families without fathers are more likely to have a single mother who works long hours and is not as available for caregiving. Recent studies have suggested that weak maternal bonding is a risk factor for early puberty.
The hunt for an explanation to this trend is significant since girls who enter puberty earlier than their peers are not only at greater risk for reproductive cancers, they are also more likely to develop asthma and engage in higher risk sexual behaviors and substance abuse, so these studies have broader relevance to women's health.
In some ways, our study raises more questions than it answers. It's definitely harder for people to wrap their minds around this than around the influence of body weight. But these findings get us away from assuming that there is a simple, clear path to the earlier onset of puberty.
The results came from the Cohort study of CYGNET (Young Girls' Nutrition, Environment and Transitions) - a project that looked at patterns of health (epidemiologic project) lead by Lawrence Kushi, associate director of etiology and prevention research at the Kaiser Permanente Northern California Division of Research.This project is part of the UC San Francisco Bay Area Breast Cancer and the Environment Research Center (BCERC), one of four centers funded by the National Cancer Institute and the National Institute of Environmental Health Sciences. Early puberty has been associated with a higher probability of developing breast cancer and reproductive cancers later in life. Kushi said:The authors explain that previous research had identified a link between early puberty and the absence of the father. However, most of those studies depended on the female remembering when her first menstrual period occurred, while a few examined what impact BMI (body mass index), ethnicity or income might have.In this latest study 444 girls aged 6 to 8 years were recruited through Kaiser Permanente Northern California, and have been monitored every year. The investigators' analysis was based on the first two years of follow-up. They considered puberty signs that emerge before the start of the first menstrual cycle (menarche). The girls were interviewed by the investigators and asked who lived in the household and what their relationship was (mother, father, brother, sister, etc.) - the girls' caregivers were present during the interviews.At the time of recruitment 80 girls said their biological father did not live in the household. The researchers were surprised to find a link with earlier breast development in higher income families in which the biological father was absent. A higher income family in this study is one whose yearly household income is at least $50,000 per year. Earlier onset of pubic hair development was only detected in African American families of higher income.In short - early breast development was found in higher income families across all ethnic groups, while early pubic hair development was found in African American higher income families.Scientists cannot explain why this occurs. Some theorize that perhaps the lack of a biological father may indicate an unstable family environment, resulting in earlier female puberty.Some have suggested that perhaps when the biological father is absent, the girls are exposed to more unrelated adult males - and their pheromones - leading to earlier puberty. In this study, however, the presence of other adult males in the household did not alter their results.The investigators cannot explain why the absence of the biological father increases the risk of early puberty among females only in higher income families, particularly African American ones.Deardorff said:The researchers wonder whether the girls in higher income without the biological father around might be exposed to more artificial light, which is known to speed up puberty in animal experiments. They also wondered whether African American girls might be more exposed to specific beauty products, such as hair straighteners, which have estrogenic properties that could have an impact on when puberty occurs.A recent study involving 1,200 girls carried out by researchers at Cincinnati Children's Hospital Medical Center revealed that approximately 15% of the girls showed the beginnings of breast development at 7 years of age.Bay Area BCERC's principal investigator Dr. Robert Hiatt, UCSF professor and co-chair of epidemiology and biostatistics, and director of population science at the campus's Helen Diller Family Comprehensive Cancer Center, said:Deardorff said:Julianna Deardorff, Ph.D., John P. Ekwaru, M.Sc., Lawrence H. Kushi, Sc.D., Bruce J. Ellis, Ph.D., Louise C. Greenspan, M.D., Anousheh Mirabedi, B.A., Evelyn G. Landaverde, M.A., and Robert A. Hiatt, M.D., Ph.D.doi:10.1016/j.jadohealth.2010.07.032Written by Christian Nordqvist | positive |
It’s official: Glen Rice Jr., 2013 Wizards second-round draftee, has been waived. As reported on Monday by CSNWashington, the Wizards planned to either trade or release Rice by today, when Rice’s contract would become guaranteed for the entirety of the season. In the eyes of Ted Leonsis and Ernie Grunfeld, the open roster spot (and subsequent veteran signing as the playoffs approach) created by Rice’s departure was ultimately more valuable than Rice’s retention or continued development.
In a little bit more than a season with the Wizards, Rice appeared in 16 games, started one, averaged 2.7 points (on 26.9% shooting), 1.5 rebounds, and 0.6 assists in 9.4 minutes per game. The Wizards traded for Rice on draft night after he was named the MVP of the NBA D-League while playing with the Rio Grande Valley Vipers. Prior to this season, Rice collected another award of sorts: the 2014 Las Vegas Summer League MVP. Many believed that Rice would contribute in 2014-15, at least while forward Martell Webster was recovering from back surgery. But despite the sub-NBA hardware, Rice could neither crack Randy Wittman’s rotation, nor his roster.
Rice has potential, to be sure. He’s a fantastic athlete and fearless with the ball in his hands. Defensively, he’s overzealous but effective. It’s all twisted up, though, with a tendency to add difficulty to otherwise straightforward shots, and, perhaps fatally, an argument with noted hardliner Randy Wittman.
On November 7, in a blowout loss to the Raptors, a presumably pre-perturbed Wittman clashed with Rice in front of the Wizards bench. Although the act of apparent insubordination was not formally addressed, Rice never played another minute with the Wizards and was sent to the D-League two weeks later. Teammates believed, according to CSNWashington, that Rice was a “great teammate who did have issues being coached.” Easily rattled by the referees in the Summer League and otherwise, Rice’s body language wasn’t always textbook, either.
John Wall gave some well-reasoned advice via CSN’s J. Michael:
“He really got frustrated, not playing, not dressing, a guy that’s young and want to prove himself it’s kind of tough to take the back seat when you’re used to playing a lot of minutes. You could tell at times when he would get frustrated not playing as much. You got to know how to accept it and just be professional. It’s not just us. Twenty-nine other teams might want to know how he’s doing in practice, how he’s competing and coming into work every day.”
It’s reminiscent in some ways of the “trade” the Wizards executed that shipped Jordan Crawford to Boston. While Crawford was talented, his relationship with Wittman was rocky. In his final days, Crawford was exiled to the end of the bench, where he built a fort out of ice packs and set a record for yawns per game. Rice, by all accounts, was never as obviously checked out as Crawford, and still has the respect of his teammates. But the common thread is that the Wizards coach, who has been integral in repairing a broken culture in the wake of the Arenas-Blatche-Young-McGee season, don’t take no stuff from nobody.
And that’s mostly a good thing. Attitudes leak and locker rooms can be smeared with the tension. One dissatisfied player can adversely affect the psyche of the rest. Still, one would think that part of getting paid to be an NBA head coach is preventative medicine, finding a way to reach a player before things go so far south.
As is the familiar refrain, Glen will likely land on his feet and develop with another team, whether it be in the NBA or overseas. Rice is a former second-round pick, a position in the draft that rarely translates to long-term success, and so it’s somewhat uncontroversial that he’s been released by a playoff team making a run at the NBA Finals in a better, but still wide-open, Eastern Conference. Any controversy is cumulative, as Rice joins a long line of promising young players that have failed to become productive for the Wizards.
While teams like the San Antonio Spurs (who carry several young, still flawed players at any given time) and others seem to be more able to draft and develop, the Wizards have released, traded, declined to sign, or otherwise left to languish Shelvin Mack, Chris Singleton, Jan Vesely, Trevor Booker, and Tomas Satoransky during John Wall’s tenure with the team. (Going back pre-Wall, Oleksiy Pecherov, Dominic McGuire, and Peter “Party” John Ramos.)
While Mack (Atlanta) and Booker (Utah) have found valuable roles with subsequent teams, Singleton (18th overall pick) and Vesely (6th overall pick) are out of the NBA after three years. Singleton got picked up by the Indiana Pacers, waived before the season, and is now toiling away in China; Vesely plays for a top team in Turkey after not showing much in Denver. Since Wall was drafted, the Wizards have also found some modicum of draft success, in that they drafted Bradley Beal with the third overall pick in 2012. It remains to be seen whether Washington’s 2013 third overall pick, Otto Porter, will become a consistent contributor.
The Wizards have had better luck filling out their roster around Wall and Beal with players that represent known values rather than still-malleable athletes without developed NBA skill. Randy Wittman recently told the Washington Post‘s Dan Steinberg that the team he inherited, chock full of young players as it was, was “career suicide.” Wittman went on, in his interview with Steinberg, to say:
“So I told [Ted Leonsis], you’re not gonna win that way. You can’t have [that many] of ‘em. We’ve got to get it to three or four, and then those other four spots we’ve got to get veteran guys in here that can teach these guys how to play. I said that’s what my belief is, and they believed it too, and that’s kind of what we’ve done.”
And so the plan shifted, from building through the draft, to building through free agency, trades, and the waiver wire. Now, with the team’s best start in decades and with the Wizards sitting as one of the four top teams in the Eastern Conference, the experience infusion seems wise, or at least effective. Hopefully the veteran turnstile keeps on turning in the years to come, because without a draft pick on the roster from the 2014 draft or a D-League affiliate, the farm is all dried up and the Wizards, once young (and awful), are one of the oldest teams in the league. | positive |
weight loss tips & resources Archives - Pria Wellness Center [email protected] Patient Portal Schedule an Appointment menu trigger menu trigger Home Our Approach Meet the Team Services Wellness Services Weight Management Hormone Replacement Age Management Chronic Disease Management Wellness Blog Primary Care Services Patient Information Schedule an Appointment Wellness Blog Insurance Coverage Purchase Supplements Patient Portal Contact Us Weight Loss Tips & Resources0 Tips for Eating Healthy: Food Storage and Preparation Making good choices and eating healthy may start at the grocery store, but it doesn’t end there. Making good choices and eating healthy may start at the grocery store, but it doesn’t end there. How you prepare and store those delicious, healthy foods matters too! When it comes to your health, there’s no such thing as being over-prepared. CONTINUE READING Search Blog Recent Posts July 31, 2020 Starting Your Morning the Right Way: Reflections on Caffeine July 24, 2020 High Fructose Corn Syrup: High Risk July 4, 2020 Follow Your Gut Feeling June 27, 2020 Achieving Balance: Testosterone in Women June 20, 2020 Being Deficient in this Vitamin Could Increase your Risk of Contracting COVID-19 Categories Categories Select Category Diet Exercise In the News Weight Loss Tips & Resources Tags beach body burning fat caffeine levels coffee coronavirus danger diabetes diet eating healthy eating well fatty liver fitness goals food storage and preparation good fats health health problems healthy eating healthy weight level hormones immune system immunity lose weight managing stress medical supervision metabolism minerals nutrition obesity pria wellness Pria Wellness Center probiotics processed food protein self-care simple changes sleep staying healthy tea type 2 diabetes vitamins weight levels weight loss weight loss program weight loss tips wellness Se Habla Español 724 Maiden Choice Lane, Ste. 202 Catonsville, MD 21228 Office Hours: Monday through Friday: 8:30am–5pm Saturday: Closed Sunday: Closed Signup for our email newsletter: Email* Comments This field is for validation purposes and should be left unchanged. © 2021 Pria Wellness Center, Medical services provided by Rodolfo Fernandez, M.D., M.H.S.A. All Rights Reserved. Website by buzzquake.com Schedule an Appointment | negative |
HBO: The Cool Kids With Nothing To Say Anymore
When it comes to original, scripted programming, HBO has firmly secured its place in the echelon of “television do-gooders”. A beautiful list of groundbreaking dramas and comedies have been birthed by this pay-channel that once had insight and, well, balls, along with the censor-less freedom to tackle any subject matter they desired. It’s the beast of this latter ability, however, alongside with general cool-hunting that has reared its ratings-hungry head in the face of what once made the channel’s original programming so wonderful and subsequently, let if fall by the wayside.
It comes as absolutely no surprise that in the past eight weeks HBO has renewed Girls for its third season and cancelled Enlightened after its tour-de-force second. Obviously, television exists in a Gladiator-esque forum wherein the bloodthirsty masses thrust gut-reaction thumbs by way of ad sales and ratings figures. The once-virgin beauty of HBO, however, eschewed this system—not only by existing as a subscription service that forewent traditional commercial breaks, but also in their creative direction to push forward with well-written, unflinching, and remarkable stories about, basically, being human. That’s what has so often worked in their favor. Maybe not always for their ratings but if not there then definitely in esteemed accolades (which then inflated their amount of subscribers anyway).
The oxygen-soaked spark of this punk television attitude came about during a post-Reagan era of strange, late-late shows. They aired, successfully, oddballs like Tales from the Crypt, Real Sex, Def Comedy Jam, The Kids in the Hall, and the seminal The Larry Sanders Show— which would bring their programming out of the midnight cult scene and pave the way for many more realistic and sharp narratives. They got in with the weird and then started refining themselves.
Throughout the mid-nineties this alternative comedy edge stayed sharp and gave us Arliss, Tenacious D, Tracy Takes On..., and the brilliant Mr. Show. Then, HBO almost completely ended their sketch sensibilities with their first hour-long drama: Oz, a chillingly realistic and deftly written tragedy about life, or lack thereof, in prison (a particularly violent show that my parents, who held strictly true to the age limits of the MPAA, actually made me watch to deter me from a life of crime—I was fifteen; it worked). Oz was the harbinger of HBO’s golden age. In the next five years earth-shattering shows such as Sex and the City, The Sopranos, Six Feet Under, and The Wire would leave their imprints in television history alongside well-tailored and beautiful mini-series like Angels in America and Band of Brothers. The amount of Emmys this half-decade period produced would be enough to melt down and fund a new space program.
If the early 90s was HBO’s “Cult” period then afterward came the period of “Storytelling,” with an intermediate phase that had a logistical crossover between them. They took steps to get there and they took them well. On the tail end of their golden age, however, another intermediate period began to develop crossing an emphasis on storytelling with what was working so well for their ratings: edgy ideas. And so were born Entourage, Deadwood, Extras*, Big Love, Flight of The Concords*, and True Blood [*although these only lasted two seasons, it’s important to note that, unlike Enlightened, they chose to cancel themselves]. These shows were still interesting enough outside of their “quirky” settings by handling their scenarios just as well as continuing to tell good, and sometimes great, stories (even if Entourage and True Blood devolved into mindless garbage over the years, both had substantial and promising beginnings that lasted more than two seasons). These shows were the tipping point, and the tail end of the “storytelling” era, that brought us into the current state of affairs at HBO: the era of “Cool”.
Concerned more with bringing in viewers in a climate of rapidly decreasing television viewership than dedicating themselves to excellent craftsmanship, HBO seemed to seek out a large amount of salacious and surprising material, with an eye on the modern youth who was more into downloading than buying premium packages through their cable provider. Hung (a show that never knew which tone it wanted to convey), How To Make It In America (a show that had most of the puzzle pieces of Girls but focused more on achieving success than on absurd confessional-ism), and Bored to Death (the only one that seemed to harbor sharp writing and a sense of fresh modernity) all failed early on. Instead of rethinking their rubric, they pushed for more ratings-bait ideas— where now the popularity of a show won over its quality.
Now, this is not to say that some shows still exist on the channel that juggle both: Game of Thrones is a masterfully handled storytelling experience, but it also had a largely built-in fanbase to begin with and has filled a fantasy void in most television viewers’ schedules. Girls and Eastbound and Down both had subtle, heart-examining first seasons worthy of many merits, but soon after started focusing more on shock with nearly robotic human interactions. But the ratings were still there, so they got to stay. Veep is too early to call and The Newsroom is too Sorkinese of a wild card.
Unfortunately, this is just how it seems to go when you have a good thing on your hands. If HBO was the punk in a Stooges jacket it was only a matter of time until he traded in his safety pins and liberty spikes for a 401k and a house in the suburbs. Maybe FX, with its shining light Louie (hey! remember when HBO fucked this up all those years ago?!), is the young-blood following in its footsteps.
This current model, this cool-huntin, is bound to fail. If I learned anything in high school it’s that trying to convince anyone else that you’re cool will tell them just the opposite. Jonah Hill’s character says in 21 Jump Street, about the current state of coolness: “liking comic books is popular, environmental awareness, being tolerant…” So does that, coupled with its complete lack of trying to be so, make Enlightened the coolest show around? Then good riddance, HBO, because House of Cards, Cougar Town, Arrested Development, and Friday Night Lights have shown us that there is life off the networks and life after cancellation.
Alan Hanson is a writer who can be found here. | positive |
When we study psychology, there is a tendency to think about the tasks that we do as if there were built-in modules in the brain dedicated to those tasks. So, we talk about and assume that there is a particular thing in the brain that helps us remember information. We talk about , and figure there must be particular brain systems that help us to pay attention.
As the science of psychology has matured, it has become clear that there are many different systems that help us with a variety of tasks. We now know, for example, that there are many different kinds of memory. Some help us remember information over the long-term and some help us to hold on to information for a few seconds or minutes. Other memory systems allow us to execute habits or to predict what is likely to happen next in a situation.
An interesting paper in the Journal of Experimental Psychology: General by Rachel Ryskin, Aaron Benjamin, Jonathan Tullis, and Sarah Brown-Schmidt examined perspective-taking as a task. Perspective-taking is the ability to take someone else’s viewpoint into account when thinking.
For example, in a classic study, Robert Krauss and his colleagues found that when people were asked to give directions to a landmark in New York City, they changed the way they described how to get to the landmark depending on whether the person asking was from the city. For other city-dwellers, people gave less specific instructions, because they assumed people would know basic aspects of navigating the city like how to get uptown versus downtown.
These researchers examined whether perspective taking was a single ability or a task that involves multiple different systems. They examined this question in an interesting way by looking at individual differences in performance on different tasks that require perspective taking. If perspective taking is a single ability, then people good at one task involving this ability should be good at other tasks involving it as well.
They selected three tasks for participants to perform across multiple sessions. In one task, participants saw a series of 80 words and were asked to generate cues that would remind them of those words in two days. This task requires people to take the perspective of themselves in a few days to figure out what would remind them of the words they saw.
Source: American Psychological Association
The second pair of tasks involved conversations between two people seated at different computer screens in separate rooms in which one person had to tell another which object on a 3 x 3 grid to click on. On each grid, there was one square that was covered so that one of the participants could not see behind it. The participant who could see behind it knew which square was blocked for the other. The image here shows examples of the materials from the paper. One square is always covered. The gray square is the one into which one participant could see while knowing the other participant could not.
With these grids, the speaker was shown one of the objects and told that the other participant should find that object on their grid. The object they were supposed to talk about was circled. (Above, it is a banana.) The key question was: When would participants use an adjective, along with the name of the object, to help the other participant?
In the situation on the left, the participant has to use the adjective big to distinguish the big banana from the small one. On the right, there is no need to use an adjective, because there is only one banana. In the middle, though, there are two bananas, but only one is visible to their partner. So from the speaker’s perspective, it should be called a big banana—but if they recognize that their partner can only see one banana, then they should not use an adjective.
Finally, participants who heard the instructions searched the grid to find the object. Participants in this study were connected to an eye tracker so that it was possible to see what they were looking at as the task progressed.
In addition to these three tasks, participants completed a number of other measures to help understand what factors lead to good performance in perspective-taking tasks. These included tests of executive function (naming the color of the font in which color words are presented—the word "green" written in a blue font, for example); working memory (the amount of information you can hold in mind at once when doing a task); and long-term memory skill (the number of words from a list people could remember).
On average, participants were reasonably good at all tasks. In the main exercise, they tended to use adjectives when they were needed and omit them when they were not necessary. They found the object that their partner was talking about and looked less at objects that were hidden from their partner than at other objects. However, there were also substantial differences on these tasks across participants.
Of interest, the correlations in performance across all three the tasks were low. So, doing well in one perspective-taking exercise did not predict how well people would do on another task. The measure of executive function did not predict individual differences in performance on any of the tasks that well. Individual differences in working memory predicted how well people would do in the memory task and also in the task in which they were the speaker. In addition, overall memory performance also predicted how well people would do on the memory task in which people found cues for themselves. None of the measures predicted how well people would do when finding objects that were labeled for them.
What does all of this mean?
The complex task of perspective-taking seems to involve a number of different abilities. You have to figure out what information someone else has access to (or what information you are likely to have in the future) and then use that information to inform what you do on the task. It appears that this task recruits many different abilities depending on the specific nature of the task you are doing. So, even though we have a single word for perspective-taking, psychologically it involves many different abilities.
One ability that does seem to be important for this task across at least a few situations is working memory. That makes sense. If you are going to take another person’s viewpoint into account, then you need to be able to keep in mind both what you are doing as well as what the other person knows. The less information you can hold in mind at one time, the less able you are to keep track of what other people know.
Finally, this study further demonstrates how careful we have to be at figuring out the basic units of thinking. There is a tendency to focus on the tasks people perform and assume the brain is organized in a way that respects these tasks. Studies like this demonstrate that every task we perform involves a variety of different more basic abilities that are brought together as needed.
One reason why this matters is that when we do neuroimaging studies to look at brain activity when people are doing a task, we often start to identify brain regions with the particular task people were performing. As this study demonstrates, though, a task like “perspective-taking” is not a single thing. So, it would be hazardous to conclude that there are particular brain regions that are associated with perspective-taking, because that complex task involves a number of more specific abilities.
Follow me on Twitter.
And on Facebook and on Google+.
Check out my books Smart Thinking and Habits of Leadership
And my latest book Smart Change.
Listen to my radio show on KUT radio in Austin Two Guys on Your Head and follow 2GoYH on Twitter and on Facebook | positive |
House Oversight Committee Shotguns Letter to Crypto Exchanges Regarding Scams, Also Sends Request to SEC, CFTC, FTC, & Treasury | Biz Builder Mike Click here - to use the wp menu builder Search You Can't Sail Todays Boat on Yesterdays Wind Home Mobile Gadgets Science Entertainment Reviews You Can't Sail Todays Boat on Yesterdays Wind Facebook Linkedin Twitter Youtube Search About Noels Law of decentralization Home Technology entrepreneur Corporate America is fretting over Taiwan risks, regulatory filings show entrepreneur Apple set to break average iPhone price record twice in coming months entrepreneur Instagram allowed self-harm images so people could ‘cry for help’, inquest hears Technology Whitepaper: Modern AppSec in financial services AI AI Top Neural Network Architectures For Machine Learning Researchers AI A new Speech Recognition Pipeline from CMU Research can recognize almost 2000 Languages without Audio AI Penn State Researchers Propose ‘ESFPNet,’ An Effective Deep Learning Network for Real-Time Lesion Segmentation in Autofluorescence Bronchoscopic Video AI Google’s New Open-Source Project, ‘SayCan,’ is an AI Tool That Uses a Large Language Model to Plan Sequences of Robotic Actions to Achieve a... More Sign in Welcome! Log into your account your username your password Forgot your password? Get help Create an account Create an account Welcome! Register for an account your email your username A password will be e-mailed to you. Password recovery Recover your password your email A password will be e-mailed to you. House Oversight Committee Shotguns Letter to Crypto Exchanges Regarding Scams, Also Sends Request to SEC, CFTC, FTC, & Treasury By JD Alois September 1, 2022 Crowd Fundingcrowdfundinsider This week, the Subcommittee on Economic and Consumer Policy, part of the House Oversight Committee, sent a letter addressing crypto scams and fraud to five crypto exchanges as well as several federal agencies. The crypto exchanges include: FTX, Binance.US, Coinbase, Kraken and KuCoin – some of the largest exchanges in the US. The Subcommittee also requested information on crypto fraud from the Securities and Exchange Commission, Commodity Futures Trading Commission, Federal Trade Commission, and the US Department of Treasury. Representative Raja Krishnamoorthi, Chair of the Subcommittee, is aiming to gather information on what these organizations are doing to counter crypto-related fraud and scams. The Chair issued the following statement: “As stories of skyrocketing prices and overnight riches have attracted both professional and amateur investors to cryptocurrencies, scammers have cashed in. The lack of a central authority to flag suspicious transactions in many situations, the irreversibility of transactions, and the limited understanding many consumers and investors have of the underlying technology make cryptocurrency a preferred transaction method for scammers. For all these reasons, I am concerned about the growth of fraud and consumer abuse linked to cryptocurrencies.” The Subcommittee states that crypto has become “scammers’ favored means of payment.” Given the lack of regulation in the digital asset sector, the federal government has been “slow to curb” crypto fraud, and current regulations do not “comprehensively or clearly cover digital assets.” The Subcommittee is looking for information to “help Congress understand what they are doing to protect consumers and inform legislative solutions to bring stability to the digital asset industry.” The letters to the crypto exchanges ask for answers to specific questions regarding policies and activities aimed at mitigating fraud. The trading platforms have until September 12, 2022, to comply. The Subcommittee has demanded similar information from the federal agencies mentioned above with the same deadline. All of the letters are linked below. While multiple bills addressing crypto regulation are circling Capital Hill, none appear ready to make it to the House floor or Senate for a vote. Meanwhile, the SEC has disintegrated into regulation by enforcement as a shortcut in lieu of bright line rules. Click here to read the letter to the Department of Treasury. Click here to read the letter to the Securities and Exchange Commission. Click here to read the letter to the Commodity Futures Trading Commission. Click here to read the letter to the Federal Trade Commission. Click here to read the letter to Binance.US. Click here to read the letter to Coinbase. Click here to read the letter to FTX. Click here to read the letter to Kraken. Click here to read the letter to the KuCoin. House Oversight Committee Shotguns Letter to Crypto Exchanges Regarding Scams, Also Sends Request to SEC, CFTC, FTC, & Treasury Republished from Source https://www.crowdfundinsider.com/2022/09/195453-house-oversight-committee-shotguns-letter-to-crypto-exchanges-regarding-scams-also-sends-request-to-sec-cftc-ftc-treasury/ via https://www.crowdfundinsider.com/feed/ Recent Articles Corporate America is fretting over Taiwan risks, regulatory filings show entrepreneur September 24, 2022 Top Neural Network Architectures For Machine Learning Researchers AI September 23, 2022 A new Speech Recognition Pipeline from CMU Research can recognize almost 2000 Languages without Audio AI September 23, 2022 Treasury Prime Enters Banking-as-a-Service Partnership with FirstBank Crowd Funding September 23, 2022 Crypto Processing Platform Calypso Pay Now Supports Subscriptions, Recurring Payments Crowd Funding September 23, 2022 Related Stories Crowd Funding Treasury Prime Enters Banking-as-a-Service Partnership with FirstBank Omar Faridi - September 23, 2022 Crowd Funding Crypto Processing Platform Calypso Pay Now Supports Subscriptions, Recurring Payments Omar Faridi - September 23, 2022 Crowd Funding Digital Investment Platform Stackwell Introduces Robo-Investing App Omar Faridi - September 23, 2022 Crowd Funding DOJ: IRS Gains Court Order to Pursue Taxpayers Who Failed to Pay Taxes on Crypto JD Alois - September 23, 2022 Crowd Funding AccessFintech Secures $60M via Series C Round Led By WestCap Omar Faridi - September 23, 2022 Crowd Funding Financial Stability Oversight Council , Re-Iterates that Digital Asset Report to be Published in October JD Alois - September 23, 2022 Stay on op - Ge the daily news in your inbox Subscribe Blog About Us ANTI-SPAM POLICY API Terms and Conditions Archive Page Biz Builder Mike is all about New World Marketing Cryptocurrency Exchange Digital Millennium Copyright Act (DMCA) Notice DMCA Safe Harbor Explained: Why Your Website Needs a DMCA/Copyright Policy How you Treat your Employees will determine the FATE of your company! Marketing? Well, how hard can that be? Michael Noel Michael Noel CBP Noels Law of decentralization Privacy Policy Blog About Us ANTI-SPAM POLICY API Terms and Conditions Archive Page Biz Builder Mike is all about New World Marketing Cryptocurrency Exchange Digital Millennium Copyright Act (DMCA) Notice DMCA Safe Harbor Explained: Why Your Website Needs a DMCA/Copyright Policy How you Treat your Employees will determine the FATE of your company! Marketing? Well, how hard can that be? Michael Noel Michael Noel CBP Noels Law of decentralization Privacy Policy You Can't Sail Todays Boat on Yesterdays Wind © Copyright - Newspaper by TagDiv | negative |
SharePoint Microsoft 365 Email Integration | Mobile, Desktop Toggle navigation c Support Request a Demo Products Overview Email Manager (for Microsoft 365 and On Premise) Content Manager for Microsoft 365 Office Connect for Microsoft 365 Briefcase (for Windows and iOS) Solutions Connect Office 365 / SharePoint Email Capture Content Distribution Industries Architecture, Engineering & Construction Energy & Utilities Government Law Firms & Legal Departments Oil and Gas Professional Services Insurance Pricing ROI Calculator Learn Blog Events & Takeaways Case Studies White Papers & eBooks Videos & Webinars Brochures Colligo Console Partner Portal Customer Support Products Overview Email Manager (for Microsoft 365 and On Premise) Content Manager for Microsoft 365 Office Connect for Microsoft 365 Briefcase (for Windows and iOS) Solutions Connect Office 365 / SharePoint Email Capture Content Distribution Industries Architecture, Engineering & Construction Energy & Utilities Government Law Firms & Legal Departments Oil and Gas Professional Services Insurance Pricing ROI Calculator Learn Blog Events & Takeaways Case Studies White Papers & eBooks Videos & Webinars Brochures Colligo Email Manager for Microsoft 365 Save & classify emails right from Outlook to SharePoint & Teams Request a DemoContact Us Email capture and collaboration made easy Rethink knowledge & record capture and sharing in the new era of Microsoft 365 mobility (previously Office 365). Save Outlook emails and attachments into the Microsoft 365 version of SharePoint and Microsoft Teams from any device. Share links to files with peers and file multiple emails & attachments at once on these collaboration platforms. Leverage the power of Microsoft’s Advanced Data Governance features by tagging your content with labels. Easy access from anywhere It’s easy to save files to your SharePoint site or Teams right from Outlook. On either communication site, it’s fast to stay in Outlook email and save directly to SharePoint to recent and favorite locations. The widget/web part has full functionality on any device, including the native mobile Outlook apps on Android and iOS. End users get the same user experience everywhere O365 goes, saving time on workflows and increasing adoption and retention. Automated and customized metadata extraction and labeling Metadata is the key to ensuring the right content is captured in the right place with the right tags. Automatically extract metadata such as To & From, with full support for field customization based on your own SharePoint content types. Prompt for labels to leverage SharePoint’s Advanced Data Governance features for records management. Seamless collaboration and content sharing Excel in team collaboration. Search for SharePoint content within the same interface and share files as links, reducing the number of 365 email attachments sent. Workers can respond any time their colleagues need information without switching Office apps. Powerful product combo: Email Manager + Content Manager for Microsoft 365 Explore SharePoint right from Outlook 365 Combine our Email Manager for 365 with Content Manager for Microsoft 365 to give users more collaboration power. Content Manager facilitates content management by letting users search, view and share links to all SharePoint intranet files right from Microsoft Outlook. Learn More Gain productivity with SharePoint and Microsoft 365 integration. Request a Trial Microsoft 365 email to SharePoint made easy Looking for more on how to save emails from Outlook to SharePoint? Check out Save Email to SharePoint from Outlook 365 with Metadata and Retention Labels. Olbia Software Inc. 300-1090 Homer Street Vancouver, BC V6B 2W9 Canada Contact Us Toll Free: +1.866.685.7962 Tel: +1 604.685.7962 Fax: +1 604.685.7969 Email: [email protected] Contact Us Sales Enquiries Toll Free: +1.866.685.7962 Email: Colligo Sales Tel: +44.203.667.3655 Email: Colligo Sales EMEA Technical Support Visit our support site Get help from the Colligo community Submit a support request Industries Architecture, Engineering & Construction Energy Utilities Government Law Firms & Legal Departments Oil and Gas Professional Services Insurance Company Overview News Team and Board Customers Partners Careers Microsoft Content Services Learn More Request a demo Request a Trial Contact Sales Colligo Login Facebook Twitter Linked © Copyright 2000-2022 Olbia Software Inc. - Privacy Policy We use cookies on this site to enhance your user experience. By clicking OK you are giving your consent for us to set cookies. View our privacy policy. OK | negative |
Construction Begins on Battery Park Pedestrian Bridge - Thomas & Hutton About Our Company Our People Our Community Our News Markets Commercial/Institutional Education Energy Government Healthcare Hospitality Industrial Mission Critical Recreation Redevelopment Residential Retail / Mixed Use Services Civil/Site Development Economic Development Environmental Funding Assistance GIS Graphics Land Planning Landscape Architecture Natural Gas Program Management Structural & Marine Surveying Transportation Water & Wastewater Water Resources Careers Why work at T&H Available Positions Contact Insights About Our Company Our People Our Community Our News Markets Commercial/Institutional Education Energy Government Healthcare Hospitality Industrial Mission Critical Recreation Redevelopment Residential Retail / Mixed Use Services Civil/Site Development Economic Development Environmental Funding Assistance GIS Graphics Land Planning Landscape Architecture Natural Gas Program Management Structural & Marine Surveying Transportation Water & Wastewater Water Resources Careers Why work at T&H Available Positions Contact Insights Construction Begins on Battery Park Pedestrian Bridge 05 Feb Construction Begins on Battery Park Pedestrian Bridge Posted at 13:28h in News Sidebar by Chelsey Falb Plans to expand the North Charleston Government Riverfront Park are underway with construction of the Battery Park Pedestrian Bridge connecting the Riverfront Park to the new Battery Park. On the Northside of Noisette Creek, Battery Park is set to revitalize 70 acres and will include restaurants and residential units. T&H provided concept design, structural design, permitting, and bidding services for the City’s vision of creating equitable access to the Riverfront and increasing mobility for all. Thomas & Hutton is also assisting the city with their plans for the redevelopment of the Battery area. Read more in The Post and Courier. Print page 0 Likes GEORGIA NORTH CAROLINA SOUTH CAROLINA TENNESSEE Copyright © 2017-2022 Thomas & Hutton. All rights reserved. | FTP Login | geothinQ | Branding SEO Address 50 Park of Commerce Way; Savannah, GA 31405 Benefits Thomas & Hutton’s approach to benefits is simple, we strive for the comprehensive enrichment of our employees. We offer zero premium, low deductible, PPO medical, dental, and RX insurance programs for employees, provided wellness program criteria are met. Vision coverage, company paid short term and long-term disability insurance, and gym membership reimbursements are also provided. We believe that adequate time for self-care and priorities outside of work are vital for feeling fulfilled, it is for this reason that we offer generous paid time off for personal, vacation, sick and bereavement purposes. Eligibility begins upon hire. In addition to paid time off, employees enjoy 8 company paid holidays annually. A condensed work schedule has been a Thomas & Hutton practice for decades, with four-hour workdays on Fridays. Connecting with each other is a major part of our culture at Thomas & Hutton. Our storied holiday parties and office gatherings are just the beginning, employees enjoy interoffice competitions like Office Olympics, Chili Cookoff, T&H Amateurs Golf Tournament where we tap into our competitive side to benefit a good cause. Employees are also given opportunities to continue their fellowship outside of the office at recreation and networking events. × × Career Development We believe each employee should take charge of their career. T&H PaTHways is a goal-setting system that focuses on personal individual career development. PaTHway prioritizes looking forward by establishing individual goals tied to T&H’s values related to self, others, clients, and community. We have flipped the script of a supervisor alone delineating expectations, PaTHways creates a mutual set of goals and expectations, PaTHways empowers the employee to drive the frequency of follow-up discussions on goals. Tapping into internal talent is necessary for the long-term success of Thomas & Hutton. Our internal Project Manager Development Program puts experienced employees who demonstrate a commitment to our vision and values on a path to a Project Manager role at Thomas & Hutton. Through a combination of mentorship and leadership opportunities, the Project Manager Development Program ensures the strength of our next generation of leadership. × Continuing Education Thomas & Hutton invests in the long-term success of our people. We offer ongoing professional development and in-house training to ensure new employees understand the design process and professional development for employees of all experience levels. Up & Ready is a training program developed to familiarize employees with company standard plan production and design processes and procedures. The program is customizable and scalable depending on skill set and experience level. T&H University is an internal technical and professional development program aimed at providing the tools necessary for each employee to continually enhance their skills and abilities. We provide resources for learning such as group classes, on-the-job training, self-paced lessons, and job aids. Thomas & Hutton is an approved continuing professional competency provider in the states where we work; enabling our employees to receive professional development credits towards their licensure. Third Thursdays is an appointment you can consistently find on our calendar. We gather once a month to explore new skills, industry trends, and company-wide achievements. This gives an opportunity for collaboration and knowledge sharing across departments and within the various regions where we work. The topics vary monthly in style and scope, sharing a single goal of keeping connected as ONE Company. × Community Thomas & Hutton is in the business of creating frameworks that allow communities to thrive. Our dedication to community service reflects that. We devote time and resources by giving back through volunteer activities and charitable donations. T&H Helping Hands is our internal monthly service program where we donate “sweat hours” to local nonprofits. Every Friday, Thomas & Hutton hosts “Jeans Day ” where donations are made to a local cause or non-profit near to the hearts of our employees in exchange for dressing down. Many of our employees are actively involved with non-profit organizations, and causes valued by our employees are a priority in our service efforts. × | negative |
Sub Contractor Tax - Easy Bookkeeping Spreadsheets Skip to content Facebook Youtube £0.00 0 0 Subtotal: £0.00 No products in the basket. Home Spreadsheets General Accounting Small Business UK Accounting & VAT Ireland Tax Calculator UK Useful Information VAT Accounting Schemes Explained FAQ’s Spreadsheet Tutorials About Making Tax Digital (MTD) for VAT My account Contact Menu Home Spreadsheets General Accounting Small Business UK Accounting & VAT Ireland Tax Calculator UK Useful Information VAT Accounting Schemes Explained FAQ’s Spreadsheet Tutorials About Making Tax Digital (MTD) for VAT My account Contact Results See all results Facebook Youtube Home Spreadsheets General Accounting Small Business UK Accounting & VAT Ireland Tax Calculator UK Useful Information VAT Accounting Schemes Explained FAQ’s Spreadsheet Tutorials About Making Tax Digital (MTD) for VAT My account Contact Menu Home Spreadsheets General Accounting Small Business UK Accounting & VAT Ireland Tax Calculator UK Useful Information VAT Accounting Schemes Explained FAQ’s Spreadsheet Tutorials About Making Tax Digital (MTD) for VAT My account Contact £0.00 0 0 Subtotal: £0.00 No products in the basket. Home Spreadsheets General Accounting Small Business UK Accounting & VAT Ireland Tax Calculator UK Useful Information VAT Accounting Schemes Explained FAQ’s Spreadsheet Tutorials About Making Tax Digital (MTD) for VAT My account Contact Menu Home Spreadsheets General Accounting Small Business UK Accounting & VAT Ireland Tax Calculator UK Useful Information VAT Accounting Schemes Explained FAQ’s Spreadsheet Tutorials About Making Tax Digital (MTD) for VAT My account Contact Results See all results Sub-Contractor Accounts And Tax Spreadsheets £14.99 Easy-to-use bookkeeping & tax spreadsheet designed specifically for independent sub-contractors, working as sole traders who wish to complete their own tax return Tax Year Choose an option2020 - 20212021 - 20222022 - 2023 Clear Sub-Contractor Accounts And Tax Spreadsheets quantity Add to basket All spreadsheets are designed using Microsoft Excel 2003, and will run on all later versions of Excel. If you do not have Microsoft Excel, then the spreadsheets are compatible with the FREE OpenOffice software, available from www.openoffice.org For any tradesmen working within the Construction Industry Scheme Easy-to-use bookkeeping & tax spreadsheet includes clear step-by-step instructions Available for individual tax years Designed specifically for non-VAT registered sub-contractors, working as sole-traders who wish to complete their own tax return Helps reduce the time you need to spend on record-keeping, simply enter details of your fee income, expenses throughout the year and your tax details and everything else is calculated automatically Provides you with a guide to your trading profit, tax & national insurance liability Helps with the completion of your self-assessment tax return Related products Taxi Driver Accounts And Tax Spreadsheets £14.99 Select options General Sole Trader Accounts And Tax Spreadsheets £14.99 Select options Driving Instructor Accounts And Tax Spreadsheets £14.99 Select options Contact 01202 568598 [email protected] Quick Links Spreadsheet Shop My Account Legal Privacy Policy Payments PayPal Verified Web Site Design Website Design: www.christchurchwebsolutions.co.uk {{{ data.variation.price_html }}} {{{ data.variation.availability_html }}} {{{data.after_title}}} {{{data.before_content}}} {{{data.content}}} {{{data.after_content}}} {{{data.rating}}} {{{data.price}}} | negative |
Senate Minority Leader Franklin Drilon allays fears that the national ID system would compromise citizens' right to privacy
Published 5:45 PM, December 04, 2017
MANILA, Philippines – The Senate is eyeing the passage of the bill seeking to create a national identification system for Filipinos by early 2018.
Senator Panfilo Lacson, chairman of the subcommittee on the national ID system, said the proposed scheme would enhance the delivery of basic services to the public, as well as prevent crimes and expedite transactions in the private sector.
Lacson said the Philippines could be considered "primitive" for being one of the few countries that do not have national ID cards.
"I will make it a commitment to pass it at least sa (in the) first quarter," Lacson told reporters after the hearing on Monday, December 4.
"[The] budget, I think the President now – the current administration is in full support, unlike in previous administrations na talagang bogged down lagi (when talks always bogged down)," he said, adding that the measure had not even reached committee hearings in the past.
To prepare for the rollout, the government has allotted P2 billion to the Philippine Statistics Authority (PSA) for 2018.
Back in September, the House of Representatives approved a similar national ID system bill on 3rd and final reading. The House version requires all Filipinos 18 years old and above, living here or abroad, to register personal data for their national IDs.
Under Lacson's proposal, however, such identification would not be mandatory.
The senator said it would take more than 5 years for the Philippines to roll out the national ID system because it does not have the required technology yet.
"Depende sa technology available, kasi minsan mapapadali kasi may mga agencies na nasa system na nila. It's just a matter of integrating them into one system called the national ID system. Right now, the PSA, 'yan ang agency in charge. But it takes a lot, kasi wala masyadong technical or IT capability ang PSA," he explained.
(It depends on the available technology because sometimes, it's expedited because there are agencies which already have the data in their system. It's just a matter of integrating them into one system called the national ID system. Right now, the PSA is the agency in charge. But it takes a lot because the PSA does not have the technical or IT capability yet.)
Privacy issues
Senate Minority Leader Franklin Drilon, who also backs the measure, addressed fears that it would violate the people's right to privacy.
Drilon said the data to be included in the national ID system would not be different from the sets of information that are already present in government-issued IDs.
"We want to debunk, for the record, the claim that the bill may affect data privacy, as the pertinent provisions of the Data Privacy Act will still apply," the senator said.
"There will be proper safeguards so as not to interfere with the individual's right to privacy. It will also be ensured that unscrupulous persons will not have access to confidential information," he added.
The PSA, through Undersecretary Lisa Grace Bersales, also dispelled fears of a possible breach of privacy. She said the agency has not had any breach in its data record.
Responding to a question from Lacson, Bersales said the issue is "a misplaced concern."
Drilon explained that a Common Reference Number (CRN) will be given to all Filipinos. The national ID will contain the CRN, along with essential information such as the person's full name, address, date and place of birth, sex, civil status, signature, and date of card issuance, along with a recent photo.
Drilon emphasized that a citizen would be able to use the national ID in transactions with all branches of government, making it more convenient for Filipinos to avail of public services.
The senator expressed confidence that the measure would be signed into law and implemented in 2018.
Both chambers of Congress have identified the bill as a priority measure of the 17th Congress. – Rappler.com | positive |
Jewelry Tattoos SnapTats big sheets Skip to content Close Newsletter Subscribe for product launches and updates Your email Subscribe Buy 2 Get 1 FREE All Stamping (discount applies on checkout) Subscribe New Beauty Nail Polish Nail Art Nail Care Dip Powder Brands Gifts Clearance Mystery Boxes Need help? Call us (480) 331-9759 [email protected] Back New Arrivals Just Launched New Nail Polishes New Stamping Plates New Beauty Back In Stock Seasonal Products Fall / Autumn Halloween Back To School Mystery Boxes Best Sellers Geodes Collection Whats Up Beauty Gust of Wind Collection Whats Up Nails Back Eyes All Eye Products Eyeshadow Palettes Eyeshadow Brushes Beauty Collections Desert Monsoon Geodes Desert Monsoon Collection Geodes Collection Back Regular Polish (A-C) All Nail Polishes Base & Top Coats A-England Bow Nail Polish Cadillacquer China Glaze Cirque Colors Color Club Colores de Carol Regular Polish (E-Z) Emily De Molly Femme Fatale F.U.N Lacquer KBShimmer OPI Orly UberChic Beauty Whats Up Nails Stamping Polish All Stamping Polishes Bow Nail Polish Emily De Molly Maniology Moyra (reg) Moyra (gel) Hit The Bottle UberChic Beauty (gel) Whats Up Nails Gel Polish All Gel Polishes Color Club Kiara Sky Le Mini Macaron Lina Nail Art Supplies Madam Glam OPI Gel Color Orly Gel FX UberChic Beauty Gel Essentials Base & Top Coats Builder Gel Gel Starter Kits Nail Tips & Forms Polish + Gel Pairs Soak Off Foils & Tools Gel Art Polish Lamps Back Stamping Plates All Stamping Plates Emily De Molly Hit The Bottle Kads Lesly Maniology MoYou-London Moyra Nicole Diary Swanky Stamping UberChic Beauty Whats Up Nails Stamping Tools Stampers & Scrapers Stamping Polishes Stamping Starter Kits Cotton Grabbers Plate Organizers Stamper Cleaners Shape Cards & Plates Stickers Nail Vinyls Opal & Chrome Stickers Strips & Stickers Water Decals Nail Decoration Chrome Powder Flakies Foils Foil Glue & Polishes Glitter & Crystals Nail Art Kits Press On Nails Tools For Nail Art Brushes Nail Barriers Dotting Tools Magnets Nail Tip Stand Holders Ombre Sponges Pick Up Tools & Tweezers Silicone Mats Water Marble Tool Back Nail Care Anti-Fungal Serum Cuticle Oils Cuticle Removers Nail Care Kit Scrubs Tools for Mani-Pedi Clippers Corrector Pen Cuticle Nippers Cuticle Pushers & Cleaners Foot Care Manicure Sets Nail Files & Buffers Soak Off Foils & Tools Toe Separators Essentials Clean Up Brushes Cotton Pads & Swabs Dry Drops Hand Sanitizers Lint Free Wipes Nail Polish Holders Nail Polish Removers Nail Repair Polish Thinners Pump Bottles Swatch Sticks Nail Care Starter Kit Crystal Nail Files Back Dip Powder All Dip Products Dip Colors Dip Essentials Dip Powder Starter Kits Dip + Acrylic Powder Back A-C All Brands A-England BioSilk Bliss Kiss Bow Nail Polish Cadillacquer China Glaze C-F Cirque Colors Color Club Colores de Carol Emily De Molly F.U.N Lacquer Fashion Nails Femme Fatale F-L Hit The Bottle IBD Kads KBShimmer Kiara Sky Le Mini Macaron Lesly M-N Maniology Mont Bleu Madam Glam MoYou-London Moyra Nicole Diary NBM O-U ONEderful OPI Orly Staleks Swanky Stamping Tweexy UberChic Beauty W-Z Whats Up Beauty Whats Up Nails Back New Arrivals Just Launched New Nail Polishes New Stamping Plates New Beauty Back In Stock Back Seasonal Products Fall / Autumn Halloween Back To School Mystery Boxes Back Eyes All Eye Products Eyeshadow Palettes Eyeshadow Brushes Back Beauty Collections Desert Monsoon Geodes Back Regular Polish (A-C) All Nail Polishes Base & Top Coats A-England Bow Nail Polish Cadillacquer China Glaze Cirque Colors Color Club Colores de Carol Back Regular Polish (E-Z) Emily De Molly Femme Fatale F.U.N Lacquer KBShimmer OPI Orly UberChic Beauty Whats Up Nails Back Stamping Polish All Stamping Polishes Bow Nail Polish Emily De Molly Maniology Moyra (reg) Moyra (gel) Hit The Bottle UberChic Beauty (gel) Whats Up Nails Back Gel Polish All Gel Polishes Color Club Kiara Sky Le Mini Macaron Lina Nail Art Supplies Madam Glam OPI Gel Color Orly Gel FX UberChic Beauty Back Gel Essentials Base & Top Coats Builder Gel Gel Starter Kits Nail Tips & Forms Polish + Gel Pairs Soak Off Foils & Tools Gel Art Polish Lamps Back Stamping Plates All Stamping Plates Emily De Molly Hit The Bottle Kads Lesly Maniology MoYou-London Moyra Nicole Diary Swanky Stamping UberChic Beauty Whats Up Nails Back Stamping Tools Stampers & Scrapers Stamping Polishes Stamping Starter Kits Cotton Grabbers Plate Organizers Stamper Cleaners Shape Cards & Plates Back Stickers Nail Vinyls Opal & Chrome Stickers Strips & Stickers Water Decals Back Nail Decoration Chrome Powder Flakies Foils Foil Glue & Polishes Glitter & Crystals Nail Art Kits Press On Nails Back Tools For Nail Art Brushes Nail Barriers Dotting Tools Magnets Nail Tip Stand Holders Ombre Sponges Pick Up Tools & Tweezers Silicone Mats Water Marble Tool Back Nail Care Anti-Fungal Serum Cuticle Oils Cuticle Removers Nail Care Kit Scrubs Back Tools for Mani-Pedi Clippers Corrector Pen Cuticle Nippers Cuticle Pushers & Cleaners Foot Care Manicure Sets Nail Files & Buffers Soak Off Foils & Tools Toe Separators Back Essentials Clean Up Brushes Cotton Pads & Swabs Dry Drops Hand Sanitizers Lint Free Wipes Nail Polish Holders Nail Polish Removers Nail Repair Polish Thinners Pump Bottles Swatch Sticks Back A-C All Brands A-England BioSilk Bliss Kiss Bow Nail Polish Cadillacquer China Glaze Back C-F Cirque Colors Color Club Colores de Carol Emily De Molly F.U.N Lacquer Fashion Nails Femme Fatale Back F-L Hit The Bottle IBD Kads KBShimmer Kiara Sky Le Mini Macaron Lesly Back M-N Maniology Mont Bleu Madam Glam MoYou-London Moyra Nicole Diary NBM Back O-U ONEderful OPI Orly Staleks Swanky Stamping Tweexy UberChic Beauty Back W-Z Whats Up Beauty Whats Up Nails Whats Up Beauty Clear All categories All categoriesBeauty CollectionBrushBufferChrome PowderClippersConfettiCotton GrabberCuticle OilCuticle PusherCuticle RemoverDip Nail PolishDip PowderDip Starter KitDotting ToolsDry DropsEmery BoardEyeshadowFlakiesFoilFoil GlueGel PolishGel Starter KitGift CardGlass Nail FileGlitterGlueHand SanitizerLampLatex Free Nail BarrierLint Free WipesLiquid Nail TapeMagnetMakeup BrushMatNail Art Starter KitNail Care Starter KitNail FormsNail PolishNail Polish RemoverNail Repair KitNail StickersNail Tip Stand HolderNail TipsNail VinylsOpal & Chrome StickersPick Up ToolPlate OrganizerPolish HolderPress On NailsPump BottleRhinestonesScraper HolderScrapersShape CardSoak Off ClipsSoak Off FoilSpongesStamperStamper CleanerStamping PlateStamping Starter KitStudsSugar ScrubSwatch DotsSwatch SticksToolTweezersWater DecalsWatermarble ToolWood Sticks Close USD $ AED د.إ AFN ؋ ALL L AMD դր. ANG ƒ AUD $ AWG ƒ AZN ₼ BAM КМ BBD $ BDT ৳ BGN лв. BIF Fr BND $ BOB Bs. BRL R$ BSD $ BWP P BZD $ CAD $ CDF Fr CHF CHF CNY ¥ CRC ₡ CVE $ CZK Kč DJF Fdj DKK kr. DOP $ DZD د.ج EGP ج.م ETB Br EUR € FJD $ FKP £ GBP £ GMD D GNF Fr GTQ Q GYD $ HKD $ HNL L HRK kn HUF Ft IDR Rp ILS ₪ INR ₹ ISK kr JMD $ JPY ¥ KES KSh KGS som KHR ៛ KMF Fr KRW ₩ KYD $ KZT 〒 LAK ₭ LBP ل.ل LKR ₨ MAD د.م. MDL L MKD ден MMK K MNT ₮ MOP P MUR ₨ MVR MVR MWK MK MXN $ MYR RM NGN ₦ NIO C$ NPR ₨ NZD $ PEN S/. PGK K PHP ₱ PKR ₨ PLN zł PYG ₲ QAR ر.ق RON Lei RSD РСД RUB ₽ RWF FRw SAR ر.س SBD $ SEK kr SGD $ SHP £ SLL Le STD Db THB ฿ TJS ЅМ TOP T$ TTD $ TWD $ TZS Sh UAH ₴ UGX USh USD $ UYU $ UZS VND ₫ VUV Vt WST T XAF Fr XCD $ XOF Fr XPF Fr YER ﷼ Login / Signup My account Login to my account Enter your e-mail and password: Email Password Login New customer? Create your account Lost password? Recover password Recover password Enter your email: Email Recover Remembered your password? Back to login Create my account Please fill in the information below: First name Last name Email Password Create my account Already have an account? Login here 0 0 Cart Your cart is empty Shop our products New New Arrivals Just Launched New Nail Polishes New Stamping Plates New Beauty Back In Stock Seasonal Products Fall / Autumn Halloween Back To School Mystery Boxes Best Sellers Geodes Collection Whats Up Beauty Gust of Wind Collection Whats Up Nails Beauty Eyes All Eye Products Eyeshadow Palettes Eyeshadow Brushes Beauty Collections Desert Monsoon Geodes Desert Monsoon Collection Geodes Collection Nail Polish Regular Polish (A-C) All Nail Polishes Base & Top Coats A-England Bow Nail Polish Cadillacquer China Glaze Cirque Colors Color Club Colores de Carol Regular Polish (E-Z) Emily De Molly Femme Fatale F.U.N Lacquer KBShimmer OPI Orly UberChic Beauty Whats Up Nails Stamping Polish All Stamping Polishes Bow Nail Polish Emily De Molly Maniology Moyra (reg) Moyra (gel) Hit The Bottle UberChic Beauty (gel) Whats Up Nails Gel Polish All Gel Polishes Color Club Kiara Sky Le Mini Macaron Lina Nail Art Supplies Madam Glam OPI Gel Color Orly Gel FX UberChic Beauty Gel Essentials Base & Top Coats Builder Gel Gel Starter Kits Nail Tips & Forms Polish + Gel Pairs Soak Off Foils & Tools Gel Art Polish Lamps Nail Art Stamping Plates All Stamping Plates Emily De Molly Hit The Bottle Kads Lesly Maniology MoYou-London Moyra Nicole Diary Swanky Stamping UberChic Beauty Whats Up Nails Stamping Tools Stampers & Scrapers Stamping Polishes Stamping Starter Kits Cotton Grabbers Plate Organizers Stamper Cleaners Shape Cards & Plates Stickers Nail Vinyls Opal & Chrome Stickers Strips & Stickers Water Decals Nail Decoration Chrome Powder Flakies Foils Foil Glue & Polishes Glitter & Crystals Nail Art Kits Press On Nails Tools For Nail Art Brushes Nail Barriers Dotting Tools Magnets Nail Tip Stand Holders Ombre Sponges Pick Up Tools & Tweezers Silicone Mats Water Marble Tool Nail Care Nail Care Anti-Fungal Serum Cuticle Oils Cuticle Removers Nail Care Kit Scrubs Tools for Mani-Pedi Clippers Corrector Pen Cuticle Nippers Cuticle Pushers & Cleaners Foot Care Manicure Sets Nail Files & Buffers Soak Off Foils & Tools Toe Separators Essentials Clean Up Brushes Cotton Pads & Swabs Dry Drops Hand Sanitizers Lint Free Wipes Nail Polish Holders Nail Polish Removers Nail Repair Polish Thinners Pump Bottles Swatch Sticks Nail Care Starter Kit Crystal Nail Files Dip Powder All Dip Products Dip Colors Dip Essentials Dip Powder Starter Kits Dip + Acrylic Powder Brands A-C All Brands A-England BioSilk Bliss Kiss Bow Nail Polish Cadillacquer China Glaze C-F Cirque Colors Color Club Colores de Carol Emily De Molly F.U.N Lacquer Fashion Nails Femme Fatale F-L Hit The Bottle IBD Kads KBShimmer Kiara Sky Le Mini Macaron Lesly M-N Maniology Mont Bleu Madam Glam MoYou-London Moyra Nicole Diary NBM O-U ONEderful OPI Orly Staleks Swanky Stamping Tweexy UberChic Beauty W-Z Whats Up Beauty Whats Up Nails Gifts Clearance Mystery Boxes Home Jewelry Tattoos SnapTats big sheets Jewelry Tattoos SnapTats big sheets This collection is empty Go to Homepage Recently Viewed Store in Chandler Mall Chandler Fashion Center 3111 W Chandler Blvd #2304 Chandler, AZ 85226 USA (480) 331-9759 Hours and Map [email protected] Help Contact Us Shipping Information Reviews AfterPay News Return Policy Refund Policy Terms and Conditions Account My Account My Wishlist My Cart Rewards Where To Buy Authorized Stockists Wholesale / Nail Tech Newsletter Subscribe for product launches and updates Your email Subscribe Currency USD $ Currency AED د.إ AFN ؋ ALL L AMD դր. ANG ƒ AUD $ AWG ƒ AZN ₼ BAM КМ BBD $ BDT ৳ BGN лв. BIF Fr BND $ BOB Bs. BRL R$ BSD $ BWP P BZD $ CAD $ CDF Fr CHF CHF CNY ¥ CRC ₡ CVE $ CZK Kč DJF Fdj DKK kr. DOP $ DZD د.ج EGP ج.م ETB Br EUR € FJD $ FKP £ GBP £ GMD D GNF Fr GTQ Q GYD $ HKD $ HNL L HRK kn HUF Ft IDR Rp ILS ₪ INR ₹ ISK kr JMD $ JPY ¥ KES KSh KGS som KHR ៛ KMF Fr KRW ₩ KYD $ KZT 〒 LAK ₭ LBP ل.ل LKR ₨ MAD د.م. MDL L MKD ден MMK K MNT ₮ MOP P MUR ₨ MVR MVR MWK MK MXN $ MYR RM NGN ₦ NIO C$ NPR ₨ NZD $ PEN S/. PGK K PHP ₱ PKR ₨ PLN zł PYG ₲ QAR ر.ق RON Lei RSD РСД RUB ₽ RWF FRw SAR ر.س SBD $ SEK kr SGD $ SHP £ SLL Le STD Db THB ฿ TJS ЅМ TOP T$ TTD $ TWD $ TZS Sh UAH ₴ UGX USh USD $ UYU $ UZS VND ₫ VUV Vt WST T XAF Fr XCD $ XOF Fr XPF Fr YER ﷼ © 2022 Whats Up Beauty 简体中文 English Français Deutsch Italiano 日本語 한국어 Русский Español Follow Us Beauty Nails We Accept American Express Apple Pay Diners Club Discover Meta Pay Google Pay Mastercard PayPal Shop Pay Venmo Visa © 2022 Whats Up Beauty 简体中文 English Français Deutsch Italiano 日本語 한국어 Русский Español Opens in a new window. | negative |
While the original Saints Row felt familiar to fans of the open-world crime genre, its sequel separated itself from the pack with almost cartoonish over-the-top action. Whether you were chainsawing elderly people in half or spraying a pool party down with a poop truck, the franchise was clearly heading in its own direction. Saints Row: The Third takes things a step forward as the most insane installment yet, and it's our April cover.
The cover above will be going out to our subscribers, while the cover below will be available on newsstands.
We'll have ten pages of information about Saints Row: The Third, including all the details on the new city and the shady Syndicate crime ring that controls it. This issue also includes a feature on Kingdoms of Amalur: Reckoning, the ambitious RPG developed by Big Huge Games and Curt Schilling's 38 Studios. Being our April issue, you can also look forward to our annual parody of the industry in Game Infarcer.
Check out page 2 for the official THQ press release regarding Saints Row: The Third, and keep an eye on our hub all month long for more coverage.
Official THQ press release:
STRAP IT ON THIS HOLIDAY WITH SAINTS ROW®: THE THIRD
THQ and Volition Inc. Take Open-World Action Over the Top and Then Some in Next Installment of Vaunted Franchise.
AGOURA HILLS, Calif. – March 3, 2011 – THQ Inc. (NASDAQ: THQI) and Volition, Inc. today announced the upcoming release of Saints Row: The Third, the highly-anticipated next installment in the multi-million unit selling Saints Row franchise.
Developed by Volition, Inc., Saints Row: The Third is scheduled for release on the Xbox 360 video game and entertainment system from Microsoft, PlayStation 3 computer entertainment system, and Windows PC this holiday season.
“Saints Row: The Third puts you on top of the world, right at the beginning of the game, with all the perks that go along with being the head of an elite criminal organization,” said Danny Bilson, THQ Executive Vice President, Core Games. “There’s no delivering pizza, no shuttling family members about in a long series of taxi missions. Instead, you take all the power of the Third Street Saints and you take the world by storm.”
The first details of Saints Row: The Third will be revealed in the exclusive cover story in Game Informer’s April issue, shipping to subscribers in early March 2011.
About Saints Row: The Third
Years after taking Stilwater for their own, the Third Street Saints have evolved from street gang to household brand name, with Saints sneakers, Saints energy drinks and Johnny Gat bobble head dolls all available at a store near you. The Saints are kings of Stilwater, but their celebrity status has not gone unnoticed. The Syndicate, a legendary criminal fraternity with pawns in play all over the globe, has turned its eye on the Saints and demands tribute. Refusing to kneel to the Syndicate, you take the fight to a new city, playing out the most outlandish gameplay scenarios ever seen. Strap it on. | positive |
Money as a concept has changed a lot over the years - from mounds of salt back in Roman times ('salary' is derived from the Latin for salt) through to gold, then innumerable currencies and now to today's vast digital transactions. Sure, there's a lot of cash still sloshing around, but the big deals are all electronic.
Increasingly that's trickling down to us consumers too - from Wave and Pay in your local city bar, paperless bank statements and Oyster cards, through to rumors that Denmark is planning to go entirely digital. old money is on the run.
What's surprising is that your established high street bank is currently all in favor of digital transactions - they're cheaper to manage and a chance to slice off a fee.
But once consumers are happy with purely conceptual money then the role of banks themselves may start to change, and there's a wealth of alternative 'versions' of cash out there which are ready to exploit the new chapter of currency.
The best-known of these alternatives is probably Bitcoin - more details on that below - and these could really change our banking world fundamentally, if enough of us decide to trust them.
The changes coming our way are pretty big: from just altering the way we spend our cash to completely new types of money that could alter the financial landscape of the world, there's a lot to get your head around - so here's some help on that front.
Bitcoin
The behemoth of digital currencies, Bitcoin isn't just an alternative method of spending money. Its creators proposed that it could replace the traditional financial system entirely, ushering in a new utopia of hassle-free, unfettered consumerism.
The key to the open-source distributed digital currency is that, unlike pounds or dollars, nobody owns or manages it, so it depends almost entirely on the trust of its users.
The central technological achievement is that all transactions are recorded publicly, within the 'blockchain cypher' which Bitcoin is based on, which means the lack of central 'owner' isn't an issue. There are many sites online where you can view Bitcoin transactions, such as this one.
Although it's free to use, it's a complicated technology to set up - there are 12 wallets recommended by the Bitcoin foundation alone, and many other options you could fiddle with if you choose.
Because it's based on open source software everybody has access to the code, including criminals, so it's vital to check that your chosen software packages are from a reputable source, and haven't been tampered with.
Finally, due to a limit on the total number of 'Bitcoins' that could ever be created, its future isn't assured as the money is literally running out.
However, the blockchain cypher which underpins Bitcoin may prove to be the long term winner, as the technology is being adopted and built upon by hundreds of companies. Maybe that new financial system will be a reality after all.
Price : Free
: Free Ease of use: 1/5
Ethereum
As Bitcoin has struggled with public perception, a more flexible and investor-friendly rival has been rocketing in value. Ethereum was crowdfunded in 2014, and is run by a Swiss non-profit.
It takes the blockchain principle - in which all transactions are automatically and publicly logged without the need for a central agency - and opens it up for developers, and indeed anyone.
Because it's decentralised anybody can use it to create almost any kind of trading system imaginable, and there are hundreds of 'apps', created by both businesses and individuals, that offer new ways to do a mind-boggling array of tasks, from credit checks to trading to noise monitoring.
The 'wallets' are standardised, so while you can create your own currency you can also buy or trade others easily. You could create your own marketplace, build contracts with anybody else on the system, or make escrow-type deals.
This flexibility built on top of blockchain has led to companies including JPMorgan Chase, Microsoft and IBM describing Ethereum as a sort of Bitcoin 2.0.
They've been investing too - JPMorgan has built a tool called Masala that lets some of its internal databases interact with an Ethereum blockchain.
On the downside, the inbuilt flexibility makes the software even more complex than Bitcoin, and Ethereum is so new that it's hard to predict how popular it will become. Still, who expects creating a new currency to be easy?
Price : Free
: Free Ease of use: 1/5
Circle
Circle is a 'social payments' app for Android, iOS and the web that aims to get you making payments more easily and cheaply than ever before.
The main thrust of this is a slick app interface, where you can send or receive money immediately (along with emoticons or GIFs to convince your contacts to pay up).
There's a group request function too, so if you've shared a cab with a group of friends you can all chip in the next day. Download the app, link a card and you're off.
The interesting bit is that there are no transaction fees at all, and you can switch currency from pounds to dollars if you like, all for free.
Part of the reason for this lovely freeness is that Circle is based on open internet standards and protocols, including blockchain, so doesn't have to deal with the costs associated with traditional banks.
However, it's far from unregulated - Circle has an Financial Conduct Authority E-Money Issuer license, the first one ever issued to a consumer internet firm for cross-border payments with blockchain technology.
It's also partnered with Barclays Bank in the UK for additional trustworthiness. As it's a relatively new launch it's hard to say how popular it'll be, but being free and 'social' never hurt...
Price : Free
: Free Ease of use: 3/5
LEOCoin
LEOcoin is based on a blockchain algorithm too, and can be mined just like Bitcoin - it's based on Litecoin code, which is a licensed variation of, but extremely similar to Bitcoin. LEOCoin aims to be 'the entrepreneurs' digital currency of choice' and goes about this by being more secure - or so the founders claim - than Bitcoin; truly anonymous, and easier to use.
The process of downloading a wallet, then either buying or 'mining' your own LEOcoins is simplified, mainly by restricting the wide-open-choice nature of Bitcoin.
Another key difference is that by just maintaining a LEOcoin 'wallet' with coins in it you automatically accrue 'interest' at 4%, by being allowed to generate additional coins.
LEOcoin points out that this "is an excellent way to convince investors to hold on to their coins for an extended period". However, the product hasn't gained widespread traction yet, being still in the soft launch phase, so perhaps don't head out and change all your cash for LEOcoins just yet.
Price : Free
: Free Ease of use: 2/5
Apple Pay / Samsung Pay / Android Pay
Mobile payments have been promised for aeons - m-wallets were touted alongside WAP all those years ago - but they're finally here, right? Well, kind of.
The technology certainly is, and if you've got an Apple device you'll be familiar with arguably the best thing the Apple Watch can do: Apple Pay. Simply wave your watch or iPhone near an enabled reader, double tapping the watch button, or holding Touch ID, and beep, you're done.
It's secure, as your actual card details aren't bandied about the ether, and it's accepted all up and down the high street - assuming the merchants have an NFC-enabled reader.
Samsung Pay is the Korean giant's answer to Apple Pay, and is currently available in the US and Korea, using Note 5 handsets and up (basically S6 and S7 variants), and only with select Visa, MasterCard and American Express cards from participating banks.
However, Samsung's use of tech called MST (Magnetic Strip Technology) as well as NFC means that non-NFC-enabled readers will be able to accept transactions, which will bring many more retailers into the fold - especially when it completes its launch in the UK.
Finally, there's Android Pay, which is more akin to Apple Pay, in that it's NFC-terminal only. It's slowly rolling out worldwide.
Download the app onto your Android 4.4 or later phone, register a card, and you're off and spending. At launch many Visa and Mastercard credit and debit cards will work with the app, although in the UK Barclays customers are locked out, due to the bank having it's own payment schemes up and running.
Price : Free
: Free Ease of use: 5/5
Paypal Touch
One of the stalwarts of the anti-cash brigade, Paypal has been pushing the 'end of real money' for more than a decade. One Touch is its latest product, which keeps you logged in on a 'trusted device', making purchases is possible in a single click.
In practice this means you enable Paypal Touch on a device - say your Macbook - and it logs the details of the device and the browser ID. That device and browser combination can then be used at PayPal merchants with a single click, and of course your source credit card or debit card number isn't shared with merchants.
There are no transaction fees for consumers, and PayPal adds an extra layer of consumer protection on top of your card issuer, so if an item doesn't arrive or is significantly not as described you can claim a refund from PayPal - often a much easier process than going through your bank.
You're also covered by PayPal's fraud protection, which monitors your transactions 24/7 for suspicious activity - although the company does recommend you don't enable One Touch on a public computer for obvious reasons. | positive |
Be the First to Review Attorneys Tax Law in Legal Menu Browse Categories Browse Recent Reviews Savings Questions & Answers Portal for Businesses search box search name search box search city Browse Category: Legal To find a business type, click on one of the Business Categories on the left. Records per Page: 5 10 25 50 1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 Click on column headers to sort up/down. 1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 Looking for a specific category? Can't find Your Business? Sign up for a TrustLink Business Account to get your company listed and to manage your online "storefront" . » Learn more about Business Benefits. About Consumers Consumers Businesses Social Media Links Contact Us Add a Business Join Trustlink Add Your Business FAQ Find a Business Forum for Consumers & Experts Manage Your Business Listing Privacy Policy Review a Business Savings & Special Offers Blog Terms of Service © Copyright 2017 TrustLink All Rights Reserved. Review Headline Review Text Select Your Rating (3 stars default) Choose the number of stars (by rolling over them) and then click. Sign In Email Password Forgot your password? Trouble Logging In? Remember Me "" | negative |
Pictured: Rodolfo Marques / Credit: Hex Fight Series
Rodolfo Marques is on a four fight win streak (MMA) and the veteran is planning on making it five at Hex Fight Series 4 when he fights again in October 2015.
Fight News Australia’s Emma Challands goes toe to toe with the BJJ black belt talking all things MMA in Australia, his dream of competing in the UFC and why he’d like to be Jose Aldo for just one day.
Fight News Australia: For those readers who don’t know your story, tell us a little about your background: how you came to find mixed martial arts, when you decided to make it a career, and how the move from Brazil to Melbourne came about?
Rodolfo Marques: I first started training in Capoeira when I was very young, about 8 years old. I played soccer for a long time but I stopped to start working to help my family. In 2004 I started training BJJ with my friend Thier Tavares and with my master, ex UFC Fighter, Rafael Carino who introduced me to MMA in 2006 when I was a blue belt and I still lived in a small city in Rio de Janeiro, Brazil. In 2008 I moved to the city to start my fight career at Nova União Central gym. I had the opportunity to train with guys like Jose Aldo, Marlon Sandro, Leo Santos , Vitor Shaolin before finally relocating to Melbourne, Australia.
Fight News Australia: How hard was it relocating to Melbourne and culturally adapting to the Australian way of life?
Rodolfo Marques: The move was made easier because of the support of my family that came with me. I feel I can adapt anywhere, anyway, especially here in Melbourne, which is the best city to live.
Fight News Australia: Your recent showing against, New Zealand based, Scott MacGregor at Minotaur 1 went the distance, however you controlled the fight from start to finish to take the win via unanimous decision. How did you see your performance and what improvements can you make going forward?
Rodolfo Marques: I trained a lot in my standing game for this fight, however I am a black belt in BJJ, and have good wrestling, so why not push the fight to my comfort zone? Anyone can punch and kick but in BJJ skill is paramount. It was a tough fight and I left some space in my game.
Fight News Australia: You’ve been exceptionally busy in 2015 with fights at Hex FS, in March and July, Minotaur 1 in mid August and Kings of Kombat, just this past weekend. Most fighters are lucky if they fight twice a year, is there a reason why you’ve decided to go down this route?
Rodolfo Marques: I have tried to work very hard for all shows that have given me fights by giving good exposure to the event via social media, with friends etc. I do a good job for them and this is my point of difference between myself and other fighters; I work hard out of the cage as well as inside. I try to fight very clean and not get injured so I can keep going on my journey.
Fight News Australia: Your last opponent was Kelly Chan at Kings of Kombat, what are your thoughts on how this fight went and why did you decide to take on a purely Muay Thai fight as opposed to an MMA fight?
Rodolfo Marques: MMA fighters are complete fighters so they can compete in any sport whether it is BJJ, boxing, kick boxing etc. My fight at Kings of Kombat was tough, I lost via split decision but I am still very happy because I am an MMA fighter first and I have nothing to prove. I took the fight to provide entertainment and have some fun inside the ring. Following Minotaur 1 I had some little injuries which effected me during the fight with Chan; he is a good fighter and I gave me best when I was there. Full Mauy Thai is not a good style for me but I decided to try it anyway. Now it’s time to rest and keep focusing on my next MMA fights.
Fight News Australia: How are you finding working on your striking with Christian Ennor, who coached Sam Soliman (former IBF World Middleweight champion)?
Rodolfo Marques: Christian was the first trainer that I found here in Melbourne as I was teaching at Extreme MMA in Melbourne and so was he. We created a good relationship that has gone from coach to friend to father figure (laughs). It is great to train with him and I have learnt many things from Sam Soliman through the process as well.
Fight News Australia: Do you believe you can compete at the highest level training here in Australia? And how do you find the overall standard compared to other countries you have experienced?
Rodolfo Marques: For sure I can! In other countries they have big teams like Nova Uniao, Blackzilians, American Top Team etc. however we have great training partners in Australia, friends and people supporting our careers. In the future, we will have strong teams in Australia that will rival all the other big teams around the world.
Fight News Australia: You have set a goal to compete at UFC193 in Melbourne in November. What do you believe you need to do to get a spot on the card?
Rodolfo Marques: So, I’m a dream fighter, a veteran holding a four fight win streak in Australia. I am also the number 1 ranked fighter in pound for pound by in the featherweight and bantamweight divisions by tapology. If I don’t deserve the shot yet, I will keep working on my journey until I get the chance.
Fight News Australia: What do you think the impact of an event like UFC193 will have on the sport of MMA in Australia?
Rodolfo Marques: More jobs and sponsors to grow our sport and the opportunity for people who don’t know the sport well to get a better understanding.
Fight News Australia: You trained with Jose Aldo back in the day, so your prediction may be a bit biased however how do you see his match up with Conor McGregor playing out?
Rodolfo Marques: I don’t think it’s an easy fight but Jose has already proved countless times that he is the complete fighter in that division.
Fight News Australia: Just for fun – if you could be anyone for a day, who would it be?
Rodolfo Marques: For sure Jose Aldo because he will smash McGregor in the cage.
Rodolfo would like to take the opportunity to thank his family, trainers Christian Ennor and Dave Tuinauvai, training partners, friends and the following sponsors: Bullterier Japan & Bossman Combat Sports. You can find Rodolfo at: Facebook: Rodolfo “the Nightmare” Marques
Instagram: @Rodolfobjj
Twitter: @Rodolf0bjj | positive |
Add a hot beverage to the Disappearing Dinosaur Mug and watch as a trio of prehistoric dinos turn to fossils. In a matter of seconds, a lush, primordial scene transforms into a museum setting ripe with skeletal displays, columns, and name plates. The microwave safe, 12-ounce mug is the perfect gift for anyone still fascinated by earth's most amazing predators.
Love our videos? Please subscribe to our YouTube channel:
Eons pass in seconds!
At Vat19.com, we have a serious infatuation with dinosaurs. Next to owning a life-size Voltron, seeing a T-Rex brought back from extinction via some crazy Jurassic Park-esque "science" would be just about the coolest thing ever.
Thus, the Disappearing Dinosaur Mug pretty much had us at "Yo," (check out this heat change mug). Simply add some hot coffee and within a few seconds the dinosaurs on this mug transform into fossils. Sweet.
See it in action!
In the short video below, you can see just how quickly hot water turns the mug's lush prehistoric setting into skeletal remains.
Colorful artwork morphs into fossil remains
The Disappearing Dinosaur Mug features three dinos. In addition to the Tyrannosaurus Rex, there's a sauropod (Brachiosaurus), and a Deinonychus (from the same family as the Velociraptor). Add a hot liquid and the prehistoric landscape disappears and morphs into a museum exhibit.
High-quality ceramic mug
The Disappearing Dinosaur Mug features thick ceramic (roughly 0.375"), a curved lip (for easy sipping), and perfectly smooth (bubble-free) glazing. Point being, they didn't skimp out on the rest of the mug in order to create the awesome heat-change effect.
Safe for the microwave
Although the special, heat-sensitive glaze requires you to hand wash this awesome mug, there is no problem using it in the microwave.
Frequently Asked Questions
Question: Can you drink tea with it?
Answer: How fortuitous that you ask! Yes, you can absolutely drink tea with it. You may want to check out our Tea-Rex mug as well.
Question: Shouldn't the Deinonychus be shown with feathers?
Answer: Yeah, we read that Wikipedia article, too. There is no definitive answer, but it is likely that it had feathers. Perhaps it lost them all due to the utter shock of having a 40-foot-long T. rex ready to rip its head off.
Question: So... hot beverages made the dinosaurs go extinct?
Answer: Sure! It's as good of a theory as any, right?
Question: Is it dishwasher safe?
Answer: No. The high temperatures of the dishwasher could damage the heat-sensitive glaze.
Question: Is there a downloadable user manual for this mug?
Answer: Not currently, but here are some tips for operating your Disappearing Dinosaur Mug. Take your hand and place it on top of the mug. Press firmly. If you are able to work your hand inside the mug, then this is the end into which you should pour your refreshment.
Question: How long does it take for the dinosaurs to go "extinct"?
Answer: That depends on the temperature of the liquid. Near-boiling water can cause the image to turn in as little as 15-20 seconds. Hot, yet still sippable beverages, will take 45-50 seconds to transform the image. Once the heated liquid is removed, it can take about 5 minutes for the image to revert to its original form. | positive |
Vintage Gaylord Brothers 9 Nine Drawer Wood Plastic Lbrary Card Catalog Cabinet Home Latest items Top items Latest videos Brand American Design (2) Antique (59) Case (5) Century (13) Curio (3) Eastlake (3) Equipto (3) Ethan Allen (5) General (4) Globe Wernicke (3) Hamilton (7) Handcrafted (3) Handmade (17) Henredon (4) Hoosier (5) Revival (2) Sellers (3) T.o.p. (5) Unknown (4) Unsigned (14) ... (4486) Door Style Arched (3) Glass (51) Panel (2) Pull Out (9) Queen Anne (2) Raised Panel (11) See Photos (2) Shaker (3) Slab (8) Sliding (3) Wood (4) ... (4552) Item Height 100 In (3) 27 In (3) 28\ (4) 29 In (7) 30 In (9) 31 In (5) 36 In (4) 36\ (3) 37 In (6) 38.5 (5) 40 In (4) 48 In (3) 58 In (4) 66 In (4) 83 In (4) 87 In (9) 90 In (6) 94.5 (4) Less Than 30 In (6) More Than 48 In (14) ... (4543) Item Width 12 In (8) 13 In (9) 14 In (6) 15 In (7) 15.5 (9) 16 In (13) 17 In (11) 18 In (24) 19 In (9) 19\ (7) 20 In (6) 21 In (6) 23 In (12) 24 In (6) 25 In (4) 26 In (6) 33 In (7) 40 In (8) 42 In (5) In Photos (4) ... (4483) Material Birch (11) Brass (50) Cherry (16) Glass (163) Mahogany (186) Maple (27) Marble (12) Metal (81) Mirror (18) Oak (979) Pine (69) Porcelain (10) Steel (37) Teak (14) Tin (10) Unknown (22) Walnut (116) Wood (379) Wood & Glass (43) Wood & Metal (26) ... (2381) Type Apothecary Cabinet (20) Bar Cabinet (50) Bookcases (21) Cabinet (875) Cabinets & Cupboards (274) Card Catalog (17) China Cabinet (173) Corner Cabinet (34) Cupboard (55) Curio Cabinet (73) Dental Cabinet (18) Display Cabinet (102) File Cabinet (277) Hoosier Cabinet (18) Hutch (25) Kitchen Cabinet (16) Medical Cabinet (60) Medicine Cabinet (30) Pie Safe (15) Storage Cabinet (55) ... (2442) Vintage Gaylord Brothers 9 Nine Drawer Wood Plastic Lbrary Card Catalog Cabinet The drawer "face" are made out of wood, but the rest of the drawers are made out of plastic. Measures approximately 20" x 17" x 13 1/2. The item "Vintage Gaylord Brothers 9 Nine Drawer Wood Plastic Lbrary Card Catalog Cabinet" is in sale since Tuesday, November 19, 2019. This item is in the category "Antiques\Furniture\Cabinets & Cupboards\1900-1950". The seller is "levinll" and is located in Holtsville, New York. This item can't be shipped, the buyer must pick up the item. Featured Refinements: card catalog Region of Origin: America Maker: Gaylord Brothers Material: Plastic Original/Reproduction: Original Type: Cabinet Color: Medium Wood Tone Time Period Manufactured: 1900-1950 mahoganycurioindustrialcabinetsdecokitchencarveddentalmetalfrenchstylelibrarycatalogmedicalhoosierdoorsantiquevintagewooddisplayapothecarydrawercabinetwalnutdoorcupboardfilechinacarddrawersstoragecenturyglassstorebookcase Home Contact Privacy Policy Agreement Terms of service | negative |
HYDMECH C Series Vertical Column Cold Saws | Structural Machinery Solutions 1-800-TALK-SAW (825-5729) [email protected] Home About Us Tech Center Machine Selection Guide Brands Machine Types Circular Saws Band Saws Thermal Processing Equipment Drill & Punch Lines Angle Lines Plate Processing Equipment Tee Splitting & Straightening Tube Processing Centers Material Handling Equipment Contact Us Select Page HYDMECH C Series Vertical Column Cold Saws HYDMECH C Series Vertical Column Cold Saws When the job calls for multi-lengths and quantities, the HYDMECH C Series offers a miter range from 60° left to 45° right and is the ideal choice for quick, clean, accurate metal cutting. Item Saw Blade Diameter Dimensions Round Solid 90° Square Solid 90° C350-2S 10 to 14 in 59 x 47 x 80 in 3-3/4 in 3-1/2 in C370-2SI 10 to 14-1/2 in 57 x 45 x 75 in 4-1/2 in 4 in C350-2CNC 10 to 14 in 84 x 47 x 80 in 3-3/4 in 3-1/2 in C370CNC 10 to 14-1/2 in 97 x 69 x 75 in 4-3/4 in 4-1/4 in CNF400CNC 10 to 15-3/4 in 97 x 70 x 75 in 5 in 4-3/4 in Note In line with Hyd-Mech’s policy of on-going product improvement, we reserve the right to modify features and specifications. Be aware that some options may not be available or are standard to the CE machines. Please check with us for option availability. Structual Machinery Solutions Maximizing your ROI Call us today 1-800-TALK-SAW (825-5729) or Contact Us Online About Us Structural Machinery Solutions, Inc. was created when Dave McCorry and Mike Drzewiecki teamed up in a 50:50 partnership to purchase Kaltenbach, Inc. from the erstwhile German parent group. The extended company portfolio now includes machinery from several other manufacturers - not just Kaltenbach. Navigation Home About Tech Center Brands Machine Types Contact Us Search Search for: Proud Member of SMS Columbus Copyright 2019 | Design by CMG | negative |
Media playback is unsupported on your device Media caption Nafissatou Diallo appeared outside court with her lawyer after the hearing
Former International Monetary Fund chief Dominique Strauss-Kahn has signed a settlement with a hotel maid who accused him of sexual assault, a New York judge says.
Details of the 63-year-old's agreement with Nafissatou Diallo will remain confidential, the judge added.
Mr Strauss-Kahn was held in New York in May 2011 after Ms Diallo, 33, said he assaulted her in his hotel suite.
Prosecutors later dropped charges amid concerns about her credibility.
The incident was widely seen as having ruined Mr Strauss-Kahn's chance of becoming the Socialist presidential candidate in his native France.
New York State Supreme Court Justice Douglas McKeon announced on Monday that after lengthy negotiations, the parties "came together and put terms of a settlement on the record".
At the scene Now that there has been a settlement, we will probably never know exactly what transpired between the head of the IMF and the immigrant hotel maid from Guinea at the hotel Sofitel in Manhattan. There was forensic evidence of a sexual encounter of some kind. Mr Strauss-Kahn insisted it was consensual, Ms Diallo said he attempted to rape her. The criminal case collapsed after the prosecution said Ms Diallo had credibility issues. Now her attempt to bring a civil case has been settled for an undisclosed amount. Two very different lives have been turned upside down by the encounter, and Mr Strauss-Kahn's ambitions to be president of France lie in ruins.
The amount of the settlement was kept confidential.
Mr Strauss-Khan did not attend the hearing, but Ms Diallo was in court.
After the settlement, the judge thanked all parties and said it was a "privilege to work with all of you".
Outside the courtroom, Ms Diallo made a short statement: "I thank everybody all over the world and everybody at the court, and God bless you all."
Her lawyer, Kenneth Thompson, said afterwards that she was "ready to move on".
In May 2011, Ms Diallo, a Guinean immigrant with a teenage daughter, said Mr Strauss-Kahn had forced her to perform oral sex when she went to clean his hotel room.
He was arrested, charged with attempted rape and forced to resign from his post at the International Monetary Fund.
Mr Strauss-Kahn had previously admitted to a "moral failing", but insisted their sexual encounter was consensual.
In the wake of Ms Diallo's accusations, other women came forward with sexual assault allegations against him. | positive |
DENVER - Coloradans considering a third-party presidential candidate have five opportunities to go see Green Party candidate Jill Stein this weekend.
The physician turned politician has events scheduled in Fort Collins, Boulder, Colorado Springs and Denver. The campaign is asking people to RVSP to each event through its website.
Here’s where the Stein campaign plans to be:
Denver: Stein plans to meet supporters Sunday from 1 to 3 p.m. at the Mercury Café located at 2199 California St.
Fort Collins: Stein is hosting a meet and greet at 6:30 p.m. in Avogadro’s Number at 605 S Mason St.
Boulder: A rally for Stein’s campaign is set for Sunday from 7 to 10 p.m. at the Glenn Miller Ballroom on the University of Colorado campus at 1669 Euclid Ave.
Colorado Springs: Stein plans to attend a rally and march Saturday, Aug. 27. Attendees should meet at noon in Acacia Park at 115 E Platte Ave.
She also plans to speak at 1 p.m. at the All Souls Unitarian Universalist Church located at 730 N Tejon St.
As of Wednesday morning, nearly 100 people had signed up to meet Stein at the Mercury Café.
Seven percent of Coloradans recently told Quinnipiac pollsters they plan to vote for Stein. That’s a big jump from the 0.3 percent of Colorado voters who picked the Green Party candidate for president in 2012.
Stein’s been actively courting Bernie Sanders supporters. The Vermont Senator won the Colorado caucus by a wide margin in April.
Stein is trailing Libertarian Party candidate Gary Johnson, though. The former New Mexico governor got 16 percent in the Colorado Quinnipiac poll.
Copyright 2016 KUSA | positive |
A German zoo has turned down a "transfer request" from Spain for its star performer during the football World Cup - Paul the "psychic" octopus.
The cephalopod correctly predicted the outcome of all of Germany's seven matches in the tournament, and also plumped for Spain to lift the trophy.
This made him an instant hero in Spain, and now Madrid's Zoo says it wants to put Paul on display in its aquarium.
But Oberhausen's Sea Life centre said there was no chance of Paul being sold.
"We're very glad that Paul will stay here," Sea Life spokeswoman Tunja Munzig said, adding that any other possible bids from abroad would be rejected.
Earlier, Madrid Zoo official Javier Diaz said the management was in talks with Oberhausen to see if the Germans wanted to exchange the 2.5-year-old octopus for "one of the species we have here".
"What they might need is coral or small sharks. But if they don't want any of that we might offer some money," Mr Diaz said.
Honorary citizen
Ever since Paul predicted Spain's triumph in the month-long tournament in South Africa, he has become a celebrity in Spain.
Fans watching last Sunday's final in Madrid sported mini-Pauls on their T-shirts and squidgy replicas on top of their hats.
The octopus is already an honorary citizen of one Spanish town, and a summer festival in Paul's name is being planned in the country.
Even Spanish Prime Minister Jose Luis Rodriguez Zapatero stepped in to offer protection, after bitter German fans threatened to eat Paul for predicting Germany's defeat in the semi-final against Spain.
One Spanish fan said that Paul should replace the bull, which is often seen on Spanish flags.
"The octopus has done more [good] things than the bull," the fan said.
But sadly for many Spaniards, Paul is staying home in Oberhausen. | positive |
PITTSBURGH (NewsRadio 1020 KDKA) – They are pretty rare in our area, but every few years the Pittsburgh area will feel an earthquake that will shake the ground enough to give us a scare. Mainstream science says that earthquakes cannot be predicted, but David Nabhan author of “Earthquake Prediction: Answers in Plain Slight” says otherwise.
Nabhan is a former teacher in California and now lives in Pittsburgh. He became interested in earthquakes while he was the earthquake preparedness coordinator for the school he worked at. He says he noticed every earthquake happened at dusk or dawn.
“I realized this sort of conscience doesn’t happen in science. These dawn and dusk quakes during new and full moons are the paradigm on the west coast,” he said. “All six great quakes that have struck in Los Angeles that have killed people since the 30s, all of them, dawn or dusk [quakes].
How can earthquakes be predicted? Nabhan says that it is the, “conjoined lunar and solar gravitational tides,” are what cause them.
“Just imagine the muscle required to move our oceans around every day. Our fractured fault lines are not immune to this [power],” he said.
Nabhan says that there has never been a new idea in science that wasn’t accepted without a fight.
So, when will the next big earthquakes happen?
Nabhan says July 12 and Sept. 9, between 4:45 to 7:55 a.m. and/or p.m.
For more information you can visit www.earthquakepredictors.com | positive |
Transcona Coun. Russ Wyatt laid the blame for delays in building an underpass on Plessis Road at the feet of city staff hired by the city's former Chief Administrative Officer, Phil Sheegl.
Sheegl quit abruptly last fall, just days before a scathing audit into firehall land swap deals was released that named him as a key figure responsible for the mess.
Wyatt confirmed the $77 million Plessis underpass project may be delayed until 2015 in order to give the city time to negotiate the temporary relocation of two pipelines with two oil companies.
"We had a CAO who I believe was not qualified," Wyatt said Wednesday. "The pattern is incompetence hires incompetence. And now we are seeing the outcome in terms of project after project and different issues we are running into."
Wyatt said the legacy of the civil servants Sheegl hired is an issue the next mayor is going to have to deal with.
"It's going to take five to 10 years to rebuild a professional civil service in this city," he said.
Wyatt said the city needs a strong, qualified CAO to run the bureaucracy.
The search to replace Phil Sheegl will take at least another two months.
Residents, businesses balk at delay
Local residents like Leo Dolan aren't happy the construction project that has shut down Plessis Road between Pandora Avenue and Dugald Road will extend even further into the future than expected.
"I think that's a shame," Dolan said Wednesday. "There's an awful lot of people out of the way because of that."
Pharmacist Christian Onyebuchi said having Plessis shut down is already costing businesses money.
"We depend on people coming through here for business," Onyebuchi said. "The more we delay, the more it sucks for everybody."
Mayor worried about losing funding
Mayor Sam Katz said his concern is that the delay will jeopardize provincial and federal funding.
"We are extremely concerned about the potential of losing any funding. That's my number one priority, to make sure we don't lose the funding."
Katz said there was talk about building a short-term access road, but that could increase the cost.
"This was an important project that was supported by all three levels of government," he said. "I also know it's extremely important to residents of Transcona and I think it's obvious to most of you that the councillor for the ward is not at all happy for the delay."
He said people have a right to be upset.
"Any time there's a delay, people get frustrated." | positive |
I have created a micro Python script, git-authors, which parses the output of git log and outputs the authors in order of their first contribution to the repository.
By itself, this is a rather boring task. However, I think the resulting code is quite interesting, because it applies a couple of really important concepts and Python idioms within just a couple of lines. Hence, this small piece of code is not only useful in practice; it also serves an educational purpose.
The latter is what this article focuses on. What can you expect to learn? Less than ten lines of code are discussed. Center of this discussion is efficient stream processing and proper usage of data structures: with a very simple and yet efficient architecture, git-authors can analyze more than 500.000 commits of the Linux git repository with near-zero memory requirements and consumption of only 1 s of CPU time on a weak machine.
Usage: pipe formatted data from git log to git-authors
The recommended usage of git-authors is:
$ git log --encoding=utf-8 --full-history --reverse "--format=format:%at;%an;%ae" | | positive |
Top 12 Rome-Campo Marzio Vacation Rentals, Apartments & Hotels | 9flats Log in or Sign up List a place Sorry, we couldn't find your location Best Rome-Campo Marzio holiday apartments Well done. Look what authentic hosts in Rome-Campo Marzio are offering to you on 9flats. Adults - + Children - + Popular accommodations in Rome-Campo Marzio Instant Booking Hotel Accommodates 4 Harry's Bar Trevi Hotel & Restaurant Just metres from Rome's Trevi Fountain, Harry's Bar Trevi Hotel & Restaurant offers modern rooms and a restaurant. WiFi is free throughout.Book now from $80 per night Instant Booking Apartment Accommodates 7 Piazza Capponi Apartment In a central area of Rome, located within a short distance of St Peter's Square and The Vatican, Piazza Capponi Apartment offers free WiFi, air conditioning and household amenities such as a fridge and kettle. The property has city views and is 1.3 km from St. Peter's Basilica and 1.8 km from Castel Sant'Angelo.Book now from $80 per night Instant Booking Apartment Accommodates 2 Ambio Suite Luxury Trastevere Set within 1.3 km of Piazza di Santa Maria in Trastevere and 2.3 km of Palatine Hill in the centre of Rome, Ambio Suite Luxury Trastevere offers accommodation with free WiFi and seating area.Book now from $80 per night Instant Booking Apartment Accommodates 8 Appartamento Lavatore Situated in Rome, less than 1 km from Palazzo Venezia and a 10-minute walk from Piazza Venezia, Appartamento Lavatore offers free WiFi and air conditioning. The property features city views and is 150 m from Trevi Fountain and 1.6 km from Piazza Barberini.Book now from $80 per night Instant Booking Other Accommodates 4 Arch Rome Suites Set in the heart of Rome within 50 metres of Largo Argentina and a 3-minute walk from the Pantheon, Arch Rome Suites offers accommodation in the heart of Rome.Book now from $58 per night Instant Booking Bed and breakfast Accommodates 4 I Tre Moschettieri - D'Artagnan I Tre Moschettieri - D'Artagnan is set in an elegant building in the heart of Rome's historical centre, near the Trevi Fountain. It offers free Wi-Fi and large, modern rooms with parquet floors and air conditioning.Book now from $58 per night Instant Booking Other Accommodates 6 Campo de' Fiori 34 Situated in Rome and within 600 metres of Largo di Torre Argentina, Campo de' Fiori 34 has a bar, allergy-free rooms, and free WiFi throughout the property. This property is set a short distance from attractions such as Palazzo Venezia, Piazza Venezia, and Campo de' Fiori. The guest house features family rooms.Book now from $65 per night Instant Booking Hotel Accommodates 3 Chapter Roma Set in a 19th-century building in Rome’s centre, Chapter Roma is a 5-minute walk from Campo de' Fiori square, and just 900 metres from the Pantheon and Piazza Navona square. It offers free Wi-Fi throughout and air-conditioned accommodation.Book now from $80 per night Instant Booking Other Accommodates 6 Navona 49 Located directly in Rome's Piazza Navona square, Navona 49 features modern air-conditioned accommodation with free WiFi and parquet floors in a renovated historical building. The Pantheon is 450 metres away on foot.Book now from $129 per night Instant Booking Apartment Accommodates 11 Piazza di Spagna Luxury big Flat In the heart of Rome, set within a short distance of Via Condotti and Spanish Steps, Piazza di Spagna Luxury big Flat offers free WiFi, air conditioning and household amenities such as a fridge and kettle. Offering private parking, the apartment is less than 1 km from Trevi Fountain.Book now from $118 per night Instant Booking Apartment Accommodates 6 Prestigious Apartment via Barberini In a central area of Rome, located within a short distance of Piazza Barberini and Quirinal Hill, Prestigious Apartment via Barberini offers free WiFi, air conditioning and household amenities such as a dishwasher and kettle. The property, housed in a building dating from 1950, is 1.7 km from Spanish Steps and 2 km from Via Condotti.Book now from $343 per night Instant Booking Apartment Accommodates 3 Raffaello Charmsuite Located in a 16th-century building, Raffaello Charmsuite offers design rooms in central Rome, 130 metres from the River Tiber and 5 minutes' walk from Piazza Navona. Wi-Fi is free throughout.Book now from $66 per night See all 7003 accommodations in Rome-Campo Marzio Information about Campo Marzio Experience Campo Marzio through the Eyes of the Locals If you are looking for evidence of the ancient Roman Empire, nowhere in Rome boasts as many historical buildings, statues and monuments as the district of Campo Marzio. Simply oozing classic Italian style, this wonderful part of the city is replete with countless examples of Rome’s power and sheer ingenuity. The remains of the Theatre of Marcellus and the infa-mous Portico of Ottavia can still be seen at Capitoline Hill – providing the perfect backdrop for a coffee, or a traditional Italian meal. While the city is filled with hotels and guest houses, a great way to experience Rome is by staying in a vacation rental in Campo Marzio. 9flats.com offers vacation rentals in Rome’s best districts, placing you in the heart of this dynamic city. Staying in this part of Rome puts you right at the heart of the city’s cultural heritage. The stunning Piazza del Popolo features the world-renowned Santa Maria del Popolo – which is home to two of Caravaggio’s masterpieces. The area surrounding the Piazza di Spagna and Via del Corso is replete with stunning buildings, narrow streets and quaint, outdoor café. It is a great place to relax and soak up the city’s unique ambience. Staying in a vacation apartment through 9flats.com gives you the chance to experience Rome like a local. Vacation Rentals in Italy and Beyond In addition to the city’s political past, Rome is famous for its renaissance artists and architects. The stunning Palazzo di Propaganda Fide was originally designed and created by Borromini, and it still serves as one of the city’s most iconic meeting places. No stay in this incredible part of Rome should pass without paying a visit to the Church of Saint Ambrogio and Saint Carlo al Corso, as it is one of Europe’s finest examples of Roman Baroque architecture. Only a short stroll away is the Piazza Augusto Imperatore, where the world-famous mausoleum of Augus-tus can be found. To explore the other dynamic districts of Rome, 9flats.com offers vacation rentals in San Pietro, an authentic residential neighborhood in the Italian capital. 9flats.com offers vacation rentals throughout all of Italy, everywhere from Florence to Sicily. And for those looking for an adventure, 9flats.com offers vacation rentals across the globe, from New York City to London, 9flats.com lets you travel in comfort and style at a fair price. Latest reviews for places in Rome-Campo Marzio 5.0 Be aware of the location as the map provided by 9Flats is not accurate. It shows the location near the Pantheon but it is an hour walk away from there. This is a 9flats issue and not the owner. The area is concerning at first due to the amount of graffiti but it turned out to be a very nice area as it is all locals with the university very close by. The restaurants in the area are amazing and half the price in the tourist area. if you don't mind commuting into the tourist area, highly recommended apartment. Don reviewed Sunny, historical mood! Between Coliseum and TErmini station in Campo Marzio 5.0 Very accommodating . Host was nice and easy to deal with language barrier as she had a translating app. Included free WiFi which wasn't working. Very clean, great view and location. Only a 6 minute walk to Vatican city. Jacquelynn reviewed il cancello degli angeli in Campo Marzio 5.0 Very new facilities, liked it very much. Its right in the center, no need for Metro or Taxi to get to St. Peter's Basilika or Colloseum. Not right in the tourist spots, so its pleasently quiet in the appartement. Super market is right around the corner. Tim reviewed Appartamento Navona 2 in Campo Marzio 4.0 The apartment was in the perfect area for getting around, it was a quite complex. The only problem with the apartment was that there had obviously been a lot of mould just before we arrived which had been cleaned off. The mould smell was excessively strong and the bed itself was damp as a result of the damp problem that the apartment had. I was able to dry the apartment out and by doing so reduce the mould smell. Even so we had to buy some room deodoriser to mask the smell straight away. While I was able to dry out the bedroom and kitchen to a degree, I struggled with the bathroom. The bathroom begun to grow mould back on the walls within 2 days of our 4 day stay. I have lived in damp places before so I knew what needed to be done. It didn't disappear but it became tolerable within a couple of days. Having said this the apartment was in the perfect place to get around which was a big plus. I was able to get rid of the dampness of the bed by the second night which also helped. Joanne reviewed Appartamento Navona 2 in Campo Marzio Discover more destinations Holiday apartment in Park City Tourist accommodation in Langenfelde Holiday house in Benidorm Budget accommodation in Davos Dorf Holiday home in Randogne Apartment airbnb in Lens Accommodation in Bogense Bed and Breakfast in Vaux-sur-Mer Apartment in Sierra Nevada Holiday apartments in Camden Vacation home in Nørre Rubjerg Holiday hotel in Triangle d'or Popular destinations around the world Popular cities in Europe Florence Berlin Amsterdam Venice Prague Rãdmiecie Lisbon Hamburg Istanbul Munich Destinations worldwide London Miami Beach Rome Milan Rļga The Hague Copenhagen San Francisco Osaka-shi Havana Popular islands and regions Tuscany Sicily Miami Beach Majorca Malta Crete Bali Canary Islands Tenerife Island Alps Home Europe Italy Lazio Rome Campo Marzio Choose your language Deutschland Österreich Schweiz United Kingdom USA España France Italia Portugal Россия 中國 Choose your currency $ AUD R$ BRL $ CAD CHF CHF kr. DKK € EUR £ GBP ¥ JPY kr NOK zł PLN ₽ RUB kr SEK ₺ TRY $ USD R ZAR $ SGD $ NZD ฿ THB Company info About 9flats Jobs Blog Legal info Terms and privacy Any questions? Help & FAQs Press Follow us ©2022 9flats. All rights reserved. close Cookies help us deliver our services. By using our services, you agree to our use of cookies. OK | negative |
Craft Subscription Packs From toucanBox (PLUS Your Chance To Win) | The Mini Mes and Me Home About Work With Us Contact The Mini Mes and Me Family | Life | Food | Travel 12 May 2015 Craft Subscription Packs From toucanBox (PLUS Your Chance To Win) Do you ever have the urge to get crafty with your children, but don’t know where to start when it comes to getting materials? It’s difficult to remember to save every gloopy lolly stick, especially when you’re out and about. If this sounds like you, then toucanBox is the answer! They make craft boxes for 3 - 8 year old children which are filled with everything required to ignite their creativity and transport them to another world. Each box contains a unique project to complete with the support of an adult... although if you’re anything like me, you’ll enjoy it just as much as your little one. We are giving you the chance to win a 3 MONTH SUBSCRIPTION to the TWO CRAFT Grande box. This contains: All the materials for 2 exciting activities Colourful instruction booklets A book to share together A parent card with more ideas and inspiration Stickers to collect and exchange for gifts A new theme every month So you can have fun being creative! For your chance to win a 3 month subscription to the two craft grande box you can enter via the Gleam entry form below. The giveaway ends at 11.59pm GMT on 23rd June 2015. Leaving a comment is mandatory but there are additional entry methods available also. Good luck! WIN a 3 Month Subscription to toucanBox ** Find my other giveaways here ** To get a FREE Petite toucan Box go to www.toucanbox.com/taster and enter my exclusive code: MINIME1 You can follow me here: Facebook // Twitter // Instagram // Pinterest Share: Posted by The Mini Mes and Me on 12 May Labels: activities, blog, Competition, craft ideas, craft kits, crafts, family, Giveaway, kids, leading, lifestyle, monthly delivery, mummy, parenting, preschool, prize, subscription boxes, top 10, toucanbox, Win 132 comments Kayla Bowe 12/05/2015, 03:28 What an awesome craft box, my daughter and I love to do crafts. It would be awesome to win thanks for the giveaway. ReplyDelete Replies sue scott 23/06/2015, 19:04 great prize looks so much fun, will keep the kids amused for ages Delete Replies Reply Reply Tracy Nixon 12/05/2015, 05:43 Beach huts and sancastles! ReplyDelete Replies Reply Jane Willis 12/05/2015, 06:28 In a family where crafting and gardening are the two main pastimes - and the grandchildren love both - I think the summer's theme should be "Things in the garden" - flowers, veg and bugs! ReplyDelete Replies Reply mummy24 12/05/2015, 06:58 The beach and sea Ashleigh ReplyDelete Replies Reply winnie 12/05/2015, 07:26 sunshine and flowers ReplyDelete Replies Reply emma walters 12/05/2015, 08:18 anything to do with the seaside ReplyDelete Replies Reply Maria Rogers 12/05/2015, 08:38 country fair ReplyDelete Replies Reply Emma Lowe 12/05/2015, 09:55 swimming pool ReplyDelete Replies Reply dorsetsgem 12/05/2015, 10:12 sea creatures ReplyDelete Replies Reply Unknown 12/05/2015, 10:28 Anything to do with the seaside ReplyDelete Replies Reply Felicity Smith 12/05/2015, 10:31 the rocky shore ReplyDelete Replies Reply The Reading Residence 12/05/2015, 10:33 These look like a lot of fun. My two love crafting and creativity, so we'll have to investigate. ReplyDelete Replies Reply Kim Neville 12/05/2015, 10:39 Blue sea and white sand ReplyDelete Replies Reply Annette Krintas 12/05/2015, 11:06 Pirates for my twin sons! ReplyDelete Replies Reply Unknown 12/05/2015, 11:07 The seaside x Blue sea and golden sand 😀 ReplyDelete Replies Reply Nadia 12/05/2015, 11:10 summer fruits. We love watermelons! :-) ReplyDelete Replies Reply chinichats 12/05/2015, 11:15 Love a Seaside theme ReplyDelete Replies Reply Deb 12/05/2015, 11:18 I think it would be a Fairy and Elf seaside or summer holiday theme for us please! Thank you for running a great competiton ReplyDelete Replies Reply bettyboop1978 12/05/2015, 11:23 seaside theme with sea creatures included ReplyDelete Replies Reply Lesley Bradley 12/05/2015, 11:31 collages made with shells ReplyDelete Replies Reply Unknown 12/05/2015, 11:38 has to be the seaside ReplyDelete Replies Reply Anonymous 12/05/2015, 11:46 Anything to do with dinosaurs for the boy. Seaside-theme would be nice too :) x ReplyDelete Replies Reply Unknown 12/05/2015, 12:30 Seaside jewellery box made with shells ReplyDelete Replies Reply susan younger 12/05/2015, 13:44 Has to be a seaside theme. ReplyDelete Replies Reply Unknown 12/05/2015, 18:19 The Egyptians as my little boy is learning about them at school. ReplyDelete Replies Reply Mandy - Parentinglove.co.uk 12/05/2015, 18:25 Beach theme :) ReplyDelete Replies Reply gemgemmum 12/05/2015, 21:58 Beaches and sandcastles ReplyDelete Replies Reply Unknown 12/05/2015, 22:02 I think making things out of summer objects, like Sand pictures for example. ReplyDelete Replies Reply mata777 12/05/2015, 22:05 Seaside ReplyDelete Replies Reply Leanne Bell 12/05/2015, 22:30 The seaside theme. ReplyDelete Replies Reply Fiona Paley 12/05/2015, 23:13 I think anything outdoorsy would be good for summer, particularly flower or tree related. ReplyDelete Replies Reply Natalie Crossan 12/05/2015, 23:15 Seaside theme xx ReplyDelete Replies Reply Anonymous 12/05/2015, 23:45 FINGER PAINTING ReplyDelete Replies Reply Kate Cass 12/05/2015, 23:49 Definitely a garden theme with sunflowers, birds, daisies and a sun or a seaside beach craft kit with boats, beach huts and ice creams maybe flip flops! Fantastic prize which Lydia & Dominic would have soooo much fun with! ReplyDelete Replies Reply Anonymous 13/05/2015, 06:27 The beach would be a good theme. Kelly glen. ReplyDelete Replies Reply Jo m welsh 13/05/2015, 06:43 Bugs and insects themes ReplyDelete Replies Reply clairebears30 13/05/2015, 08:20 beaches would be my summer theme. ReplyDelete Replies Reply clairew137 13/05/2015, 09:21 Beach and sunny days. ReplyDelete Replies Reply Elizabeth Hinds 13/05/2015, 09:49 Anything to do with holidays - the seaside, ice creams, sunshine, days out etc :-) ReplyDelete Replies Reply Sarah 13/05/2015, 10:00 The seaside ReplyDelete Replies Reply Sarah Lee 13/05/2015, 10:09 A day at the beach would be the perfect theme ReplyDelete Replies Reply Zoe G 13/05/2015, 10:15 Garden theme ReplyDelete Replies Reply Tanya Camilleri 13/05/2015, 11:21 Seaside - animals :) ReplyDelete Replies Reply h tovell 13/05/2015, 11:23 the beach ReplyDelete Replies Reply rugby76 13/05/2015, 12:19 Insects, I like to give my son lots of information about them so he isn't scared. ReplyDelete Replies Reply Caroline 13/05/2015, 12:31 Fruit and veg - to craft the results of a summer's gardening. ReplyDelete Replies Reply Unknown 13/05/2015, 12:38 The Seaside - kids love everything to do with the sea. ReplyDelete Replies Reply Paula Readings 13/05/2015, 12:58 Ice Cream & Rock ReplyDelete Replies Reply Anonymous 13/05/2015, 13:34 The seaside, just everything to do with it, shells, sea animals/creatues, ice-cream, sandcastles, etc. Maybe even mermaids!! Keeley Shaw ReplyDelete Replies Reply Unknown 13/05/2015, 13:52 The seaside! ReplyDelete Replies Reply Sarah Cooper 13/05/2015, 15:09 Seaside ReplyDelete Replies Reply Gillian 13/05/2015, 18:14 I hope that we will be lucky with the weather & can do lots of outside crafts - painting stones & making story stones, making pictures from natural resources, water play etc ;) xx ReplyDelete Replies Reply Anonymous 13/05/2015, 18:50 The beach @rachiegr ReplyDelete Replies Reply Michael McAulay 13/05/2015, 20:05 Sunshine and white sand! ReplyDelete Replies Reply kasza 13/05/2015, 20:58 Garden and wildlife ReplyDelete Replies Reply Isis1981uk 13/05/2015, 21:07 Some kind of beachcombing box ReplyDelete Replies Reply Vicky Osborne 13/05/2015, 21:18 Sand castles and beaches ReplyDelete Replies Reply Mel Daniels 13/05/2015, 22:16 Gardening and growing things :) ReplyDelete Replies Reply Angie McDonald 14/05/2015, 02:41 Carnival Theme! ReplyDelete Replies Reply Ali Johnson 14/05/2015, 08:38 Decorating plant pots & then putting easy grow flowers in them ReplyDelete Replies Reply E 14/05/2015, 16:29 Plants and lifecycles theme ReplyDelete Replies Reply Kaypmumof3xx 14/05/2015, 21:29 Got to be the seaside Kay Panayi ReplyDelete Replies Reply Anonymous 15/05/2015, 09:37 Summer flowers Fiona S ReplyDelete Replies Reply debbie smith 16/05/2015, 14:27 seaside !!! fab giveaway xx ReplyDelete Replies Reply Unknown 16/05/2015, 17:27 The seaside! ReplyDelete Replies Reply Susie Wilkinson 17/05/2015, 23:29 Fluffy white clouds and rainbows ReplyDelete Replies Reply Angela Cole 18/05/2015, 11:58 Something to do with mountains, and colourful flowers. ReplyDelete Replies Reply jodie yorke 18/05/2015, 12:48 swimming pool. ReplyDelete Replies Reply kris 19/05/2015, 14:49 butterflies ReplyDelete Replies Reply Unknown 19/05/2015, 22:32 Festival fun! ReplyDelete Replies Reply mellysocks 19/05/2015, 23:23 The seaside. ReplyDelete Replies Reply Sarah Lambert 20/05/2015, 14:02 I love the seaside theme :) ReplyDelete Replies Reply whitbyranger 22/05/2015, 15:01 Sea shells ReplyDelete Replies Reply Kristy Brown 22/05/2015, 21:09 Under the sea ReplyDelete Replies Reply Janice Mackin 22/05/2015, 23:09 A beach theme. ReplyDelete Replies Reply Unknown 23/05/2015, 00:04 sea creatures ReplyDelete Replies Reply Anonymous 23/05/2015, 09:25 My nearly 3 year old niece and I are doing lots of matchcraft. ReplyDelete Replies Reply Unknown 23/05/2015, 18:30 The Garden x ReplyDelete Replies Reply Unknown 24/05/2015, 15:02 Beach themed ReplyDelete Replies Reply Jenni 25/05/2015, 17:18 Woodland theme =) ReplyDelete Replies Reply Jane 26/05/2015, 17:50 Disney ReplyDelete Replies Reply Natasha Mairs - Serenity You 27/05/2015, 20:00 anything with ice creams! ReplyDelete Replies Reply Hannah Igoe 31/05/2015, 21:31 Bugs in the garden ReplyDelete Replies Reply Stephanie Campbell 02/06/2015, 12:04 the beach! ReplyDelete Replies Reply Unknown 02/06/2015, 14:46 Perfect theme for summer would be summer BBQ ReplyDelete Replies Reply Unknown 02/06/2015, 17:11 seaside ReplyDelete Replies Reply Emccrubb 06/06/2015, 22:07 the seaside ReplyDelete Replies Reply Solange 09/06/2015, 22:06 The seaside ReplyDelete Replies Reply renae 10/06/2015, 21:51 summer, sunshine, rainbows and swimming ReplyDelete Replies Reply Tanya Camilleri 11/06/2015, 14:32 stained glass windows from tissue paper...they would look great on my patio doors with the sun shining in ReplyDelete Replies Reply Kerry-Ann Pope 12/06/2015, 12:48 Our theme would be nature, as the summer time is the best time to see Mother Nature at it's best. ReplyDelete Replies Reply Unknown 13/06/2015, 22:01 We've been doing some sand art pictures! ReplyDelete Replies Reply anna 13/06/2015, 23:10 seaside, shells and sand ReplyDelete Replies Reply Rachel Berryman 14/06/2015, 09:27 Fruit!!! I think fruit is a great summer theme :) xx ReplyDelete Replies Reply Catherine McAlinden 14/06/2015, 09:35 Sand castles! ReplyDelete Replies Reply Anonymous 14/06/2015, 10:13 seaside theme x ( melissa crowe) ReplyDelete Replies Reply pretty pistol 14/06/2015, 10:27 sea creatures x ReplyDelete Replies Reply Helen Neale 14/06/2015, 10:28 probably not been said before, but I love mountains and lakes in the summer, so that's what it would be for me! ReplyDelete Replies Reply Layla Thomas 14/06/2015, 12:35 I think my son's theme right now would be dinosaurs because with Jurassic World in the theatres his love of dinosaurs has started again. ReplyDelete Replies Reply Unknown 14/06/2015, 22:08 Anything to do with flowers would be lovely :) ReplyDelete Replies Reply modzy78 14/06/2015, 22:35 For my daughter, anything to do with transportation. She's obsessed with busses, trains, cars, and planes. ReplyDelete Replies Reply Unknown 15/06/2015, 19:46 The seaside! ReplyDelete Replies Reply Unknown 17/06/2015, 13:46 Sea shells ReplyDelete Replies Reply Mummy Fever 17/06/2015, 17:35 Beach ReplyDelete Replies Reply Tracy B 20/06/2015, 20:33 Seaside ReplyDelete Replies Reply Unknown 20/06/2015, 22:35 Sunshine and icecreams ReplyDelete Replies Reply sam 20/06/2015, 22:41 I think a great kids craft for summer would be making paper windmills or maybe flowers. ReplyDelete Replies Reply lucyrobinson 20/06/2015, 22:59 THE SEASIDE. X ReplyDelete Replies Reply Doodygirl 21/06/2015, 11:40 Sun and beach ReplyDelete Replies Reply antheaholloway 21/06/2015, 19:02 Fruit and vegetables ReplyDelete Replies Reply Amy Beckett 21/06/2015, 20:11 Lollipop superheroes ReplyDelete Replies Reply Kat Allinson 21/06/2015, 21:40 Seaside ReplyDelete Replies Reply fun as a gran 22/06/2015, 07:57 My daughter buys these for the grandson every month, he loves them and looks forward to them coming, so for anybody who does not win they are a great buy ReplyDelete Replies Reply Alison O 22/06/2015, 09:57 Summer picnics ReplyDelete Replies Reply Unknown 22/06/2015, 12:48 Anything involving summer wildlife like ladybirds and butterflies x ReplyDelete Replies Reply Samantha O'D 22/06/2015, 18:09 seaside theme ReplyDelete Replies Reply WeeWillieWilkie 22/06/2015, 21:10 Sea side ReplyDelete Replies Reply Anonymous 22/06/2015, 22:26 sun and flowers ReplyDelete Replies Reply Unknown 23/06/2015, 00:21 ocean theme ReplyDelete Replies Reply Erica Price 23/06/2015, 06:50 Seaside ReplyDelete Replies Reply daniel pol 23/06/2015, 07:32 seaside ReplyDelete Replies Reply Anonymous 23/06/2015, 08:14 Sand and shell theme,great giveaway I enjoy crafting it is my favourite way to unwind. ReplyDelete Replies Reply Lynsey Poole 23/06/2015, 10:19 Anything to do with the seaside, or outdoors in general! ReplyDelete Replies Reply Rich Tyler 23/06/2015, 11:15 Lazy Summertime theme ReplyDelete Replies Reply George Worboys Wright 23/06/2015, 13:05 Seashells & driftwood ReplyDelete Replies Reply Clare 23/06/2015, 13:41 the garden ReplyDelete Replies Reply emma kinsey 23/06/2015, 14:16 beach theme ReplyDelete Replies Reply jo-anne 23/06/2015, 14:19 Got to be the beach, good old see side theme!!! ReplyDelete Replies Reply Diana 23/06/2015, 16:32 Sand and seashells :) ReplyDelete Replies Reply Cat1980uk 23/06/2015, 16:59 Seaside. Living in Blackpool it has to be ReplyDelete Replies Reply Karis 23/06/2015, 23:00 Beach ReplyDelete Replies Reply Add comment Load more... Thanks for taking the time to stop by. We love to hear your thoughts - feel free to pop a comment in the box! Newer Post Older Post Home Subscribe to: Post Comments (Atom) I'm Emma - an adventure seeking mama of two, with another little one on the way this winter, based in Northamptonshire. With a passion for travel I'm always planning the next trip, whether that's to visit a popular attraction, explore a local town or sink our toes into foreign sands. Feel free to follow our journey or get in touch, Pinterest WIN View our giveaways here Two Tone Star Biscuits Raspberry Crumble Slices Powered by Blogger. Follow Us © The Mini Mes and Me | All rights reserved. Blogger Template Created by pipdig | negative |
Sex columnist, “It Gets Better” founder and White House guest Dan Savage was speaking metaphorically, of course, when he told a group of students at Winona State University in Minnesota last week that Family Research Council President Tony Perkins “sits on a pile of dead gay kids every day when he goes to work.”
It’s an even more tasteless comment than usual from “anti-bullying” crusader Savage, who called a group of teens “pansy asses” as they walked out of a Christian-bashing speech and said he’s less interested in seeing Mitt Romney’s heart than his “liver and spleen.” After all, Perkins and others at the Family Research Council’s headquarters were fired upon in August by a volunteer at an LGBT organization. Helping to foment anger against the FRC were claims by the Southern Poverty Law Center that the FRC is an “official” hate group — a claim Savage repeats to his audience.
It’s bad enough that, after news of the shooting broke, Twitter lit up with comments that the FRC “totally had it coming.” Savage hopes to keep the FRC in the crosshairs, though, outrageously claiming in his speech that “every dead gay kid’s a victory for the Family Research Council” and that they group will do “everything in their power to make sure that suicide rate does not come down.”
The White House’s favorite “anti-bullying crusader” also got in a shot in at Republicans, saying that the country still has a race problem (“Obviously we do, it’s called the GOP”) and lamenting that “We will always have ignorant dicks like Michele Bachmann and her fag husband.”
CampusReform.org called out Savage on his appearance, but not surprisingly, Savage isn’t backing down.
I'm Dan Savage and I approved — and stand by — this message: http://t.co/ZTMWCyzo — Dan Savage (@fakedansavage) October 1, 2012
@fakedansavage wait are we supposed to condemn you for speaking the truth about the FRC? — fight apathy or dont (@rowast) October 1, 2012
One fan called the appearance “funny.”
Dan Savage was brilliant, funny, irreverent, & absolutely inspiring during the talk he gave on "It gets better" at Winona State last night! — Andrea Wood (@a_d_wood) September 28, 2012
Funnier still was the rainbows and sunshine headline in the Winona Daily News hailing the event: “Writer, activist Dan Savage creates hope for LGBT youth.” | positive |
How you can help Legalize Privacy | Center for the Legalization of Privacy About Center for the Legalization of Privacy ~ protecting privacy via property and contract Search: How you can help Legalize Privacy 02 Thursday Apr 2020 Posted by amyp in Uncategorized ≈ 1 Comment I’ve recently started getting inquiries about how to set up regular monthly donations to CLP. If you are interested in doing this–and I explained why you should be, especially at this time, on yesterday’s show (below)–here’s an easy way to do so: DONATE NOW Thank you so much for your support! Share this: Twitter Facebook Like this: Like Loading... Related Post navigation ← Previous post Next post → 1 thought on “How you can help Legalize Privacy” Tom Hall said: April 19, 2020 at 6:16 am Judge dismisses Twitter lawsuit that sought to reveal government surveillance requests https://www.theverge.com/2020/4/18/21226247/judge-dismisses-twitter-lawsuit-surveillance Reply Leave a Reply Cancel reply Enter your comment here... Fill in your details below or click an icon to log in: Email (required) (Address never made public) Name (required) Website You are commenting using your WordPress.com account. ( Log Out / Change ) You are commenting using your Twitter account. ( Log Out / Change ) You are commenting using your Facebook account. ( Log Out / Change ) Cancel Connecting to %s Notify me of new comments via email. Notify me of new posts via email. Δ Subscribe Entries (RSS) Comments (RSS) Archives May 2020 April 2020 January 2020 October 2019 September 2019 August 2019 July 2019 December 2014 Categories Uncategorized Meta Register Log in Create a free website or blog at WordPress.com. Privacy & Cookies: This site uses cookies. By continuing to use this website, you agree to their use. To find out more, including how to control cookies, see here: Cookie Policy Follow Following Center for the Legalization of Privacy Sign me up Already have a WordPress.com account? Log in now. Center for the Legalization of Privacy Customize Follow Following Sign up Log in Copy shortlink Report this content View post in Reader Manage subscriptions Collapse this bar %d bloggers like this: | negative |
Orlando Dunk Tank Rental | Dunking Booth With Target | Rent Dunk Tank Skip to main content Email: [email protected] Phone: 407-936-7555 Address: 930 Britt Court, Altamonte Springs, FL 32701 Hit enter to search or ESC to close Close Search search Menu Home About Careers Rentals Bounce Houses Inflatable Slides & Dunk Tank Obstacle Courses Extreme Attractions Midway Game Trailers Electronic Arcade / LED Glow Games Carnival Games & Concessions Themed Events Easter / Spring Festival Tropical Luau / Beach Party Halloween / Fall Festival Christmas / Winter Wonderland Country & Western Patriotic 80’s Game Night / Arcade Nostalgic Carnival Event Planning Orlando Trade Show Rentals College Events Community Events Corporate Events Holiday Events Safety and Setup Blog Contact Us search Dunk Tank Dunk Tank Dimensions: 15’L x 10’W x 10’H Requirements: 20Amp, 110v electrical, Water Access The never ending fun of the classic dunk tank can be yours with the help of Fun Crew USA. Everyone loves to dunk their boss, coach and even teacher, making this the perfect fundraiser dunk tank rental for your school carnival. Our 500 gallon dunk tank rental is considered top of the line with the bright blue tub, steel safety cage and menacing shark head. Create the exciting party experience guests will talk about for years to come and rent a dunk tank in Orlando today. Reserve This Rental! Notice: JavaScript is required for this content. Previous Product Next Product Share Tweet Share Pin 407-936-7555 [email protected] 930 Britt Court Altamonte Springs, FL 32701 Certifications Contact Us Notice: JavaScript is required for this content. © 2022 Fun Crew USA. All Rights Reserved | Digital Marketing via iFame Media, LLC facebook pinterest Close Menu Home About Careers Rentals Bounce Houses Inflatable Slides & Dunk Tank Obstacle Courses Extreme Attractions Midway Game Trailers Electronic Arcade / LED Glow Games Carnival Games & Concessions Themed Events Easter / Spring Festival Tropical Luau / Beach Party Halloween / Fall Festival Christmas / Winter Wonderland Country & Western Patriotic 80’s Game Night / Arcade Nostalgic Carnival Event Planning Orlando Trade Show Rentals College Events Community Events Corporate Events Holiday Events Safety and Setup Blog Contact Us Email: [email protected] Phone: 407-936-7555 Address: 930 Britt Court, Altamonte Springs, FL 32701 {{{ data.beforeFields }}} <# /* * Render our error section if we have an error. */ #> <# /* * Render any custom HTML after our field. */ #> {{{ data.afterField }}} <# /* * Render our Description Text. */ #> {{{ data.renderDescText() }}} {{{ data.renderElement() }}} | negative |
Arun's code - phpfspot.git/log projects / phpfspot.git / log commit grep author committer pickaxe ? search: re summary | shortlog | log | commit | commitdiff | tree first ⋅ prev ⋅ next phpfspot.git 15 years agoissue46, added a nice slideshow icon commit | commitdiff | tree Andreas Unterkircher [Fri, 20 Jul 2007 21:56:36 +0000 (21:56 +0000)] issue46, added a nice slideshow icon git-svn-id: file:///var/lib/svn/phpfspot/trunk@227 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue46, center img, link to close the slideshow window commit | commitdiff | tree Andreas Unterkircher [Fri, 20 Jul 2007 21:51:30 +0000 (21:51 +0000)] issue46, center img, link to close the slideshow window git-svn-id: file:///var/lib/svn/phpfspot/trunk@226 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue46, first slideshow implementation commit | commitdiff | tree Andreas Unterkircher [Fri, 20 Jul 2007 17:59:03 +0000 (17:59 +0000)] issue46, first slideshow implementation git-svn-id: file:///var/lib/svn/phpfspot/trunk@225 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agofixed SQL syntax error on AND conjunction of multiple tags commit | commitdiff | tree Andreas Unterkircher [Thu, 19 Jul 2007 14:27:22 +0000 (14:27 +0000)] fixed SQL syntax error on AND conjunction of multiple tags git-svn-id: file:///var/lib/svn/phpfspot/trunk@224 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue54, sort order can now be modified commit | commitdiff | tree Andreas Unterkircher [Wed, 18 Jul 2007 18:03:28 +0000 (18:03 +0000)] issue54, sort order can now be modified git-svn-id: file:///var/lib/svn/phpfspot/trunk@223 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoreset is not only reseting selected-tags anymore, changed text commit | commitdiff | tree Andreas Unterkircher [Wed, 18 Jul 2007 04:13:24 +0000 (04:13 +0000)] reset is not only reseting selected-tags anymore, changed text git-svn-id: file:///var/lib/svn/phpfspot/trunk@222 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue51, fixed incorrect value returned from whattodo() commit | commitdiff | tree Andreas Unterkircher [Wed, 18 Jul 2007 04:10:43 +0000 (04:10 +0000)] issue51, fixed incorrect value returned from whattodo() git-svn-id: file:///var/lib/svn/phpfspot/trunk@221 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue50, date range _within_ not _between_ commit | commitdiff | tree Andreas Unterkircher [Wed, 18 Jul 2007 04:03:36 +0000 (04:03 +0000)] issue50, date range _within_ not _between_ git-svn-id: file:///var/lib/svn/phpfspot/trunk@220 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue50, further code changes to be able to combine tag- and date-search commit | commitdiff | tree Andreas Unterkircher [Tue, 17 Jul 2007 20:24:56 +0000 (20:24 +0000)] issue50, further code changes to be able to combine tag- and date-search git-svn-id: file:///var/lib/svn/phpfspot/trunk@219 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue45, first learning lessons with image preloading commit | commitdiff | tree Andreas Unterkircher [Tue, 17 Jul 2007 17:37:31 +0000 (17:37 +0000)] issue45, first learning lessons with image preloading git-svn-id: file:///var/lib/svn/phpfspot/trunk@218 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue50, on date-search don't touch the current tag selection commit | commitdiff | tree Andreas Unterkircher [Tue, 17 Jul 2007 17:36:23 +0000 (17:36 +0000)] issue50, on date-search don't touch the current tag selection git-svn-id: file:///var/lib/svn/phpfspot/trunk@217 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue51, first fix for external link to a photo commit | commitdiff | tree Andreas Unterkircher [Tue, 17 Jul 2007 04:16:10 +0000 (04:16 +0000)] issue51, first fix for external link to a photo git-svn-id: file:///var/lib/svn/phpfspot/trunk@216 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue53, avoid makeing to many ... in the page selector commit | commitdiff | tree Andreas Unterkircher [Tue, 17 Jul 2007 04:10:42 +0000 (04:10 +0000)] issue53, avoid makeing to many ... in the page selector git-svn-id: file:///var/lib/svn/phpfspot/trunk@215 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agofixed image taken with text commit | commitdiff | tree Andreas Unterkircher [Sun, 15 Jul 2007 17:58:37 +0000 (17:58 +0000)] fixed image taken with text git-svn-id: file:///var/lib/svn/phpfspot/trunk@214 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue47, long photo names now getting wraped commit | commitdiff | tree Andreas Unterkircher [Sun, 15 Jul 2007 16:09:02 +0000 (16:09 +0000)] issue47, long photo names now getting wraped git-svn-id: file:///var/lib/svn/phpfspot/trunk@213 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue49, fixed display header text in photo index commit | commitdiff | tree Andreas Unterkircher [Sun, 15 Jul 2007 15:48:26 +0000 (15:48 +0000)] issue49, fixed display header text in photo index git-svn-id: file:///var/lib/svn/phpfspot/trunk@212 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue48, make sure no pending comma is shown at the end of the available-tags commit | commitdiff | tree Andreas Unterkircher [Sun, 15 Jul 2007 15:10:42 +0000 (15:10 +0000)] issue48, make sure no pending comma is shown at the end of the available-tags git-svn-id: file:///var/lib/svn/phpfspot/trunk@211 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoadded many function comments for phpDocumentor commit | commitdiff | tree Andreas Unterkircher [Sun, 15 Jul 2007 15:06:23 +0000 (15:06 +0000)] added many function comments for phpDocumentor git-svn-id: file:///var/lib/svn/phpfspot/trunk@210 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoadded GPL headers to all PHP scripts commit | commitdiff | tree Andreas Unterkircher [Sun, 15 Jul 2007 11:52:57 +0000 (11:52 +0000)] added GPL headers to all PHP scripts git-svn-id: file:///var/lib/svn/phpfspot/trunk@209 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue43, also return a thumbnail if requested width is below image size commit | commitdiff | tree Andreas Unterkircher [Sun, 15 Jul 2007 09:31:55 +0000 (09:31 +0000)] issue43, also return a thumbnail if requested width is below image size git-svn-id: file:///var/lib/svn/phpfspot/trunk@208 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue43, fixed on-the-fly thumbnail generation commit | commitdiff | tree Andreas Unterkircher [Sun, 15 Jul 2007 09:19:50 +0000 (09:19 +0000)] issue43, fixed on-the-fly thumbnail generation git-svn-id: file:///var/lib/svn/phpfspot/trunk@207 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoget_current_user() returns the OWNER of the php script - now we use posix functions... commit | commitdiff | tree Andreas Unterkircher [Sun, 15 Jul 2007 08:50:33 +0000 (08:50 +0000)] get_current_user() returns the OWNER of the php script - now we use posix functions to get the current process user git-svn-id: file:///var/lib/svn/phpfspot/trunk@206 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agocheck if directory of phpfspot.db is writeable commit | commitdiff | tree Andreas Unterkircher [Sun, 15 Jul 2007 08:37:02 +0000 (08:37 +0000)] check if directory of phpfspot.db is writeable git-svn-id: file:///var/lib/svn/phpfspot/trunk@205 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoremove a unnecessary AJAX call commit | commitdiff | tree Andreas Unterkircher [Sat, 14 Jul 2007 13:56:48 +0000 (13:56 +0000)] remove a unnecessary AJAX call git-svn-id: file:///var/lib/svn/phpfspot/trunk@204 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue27, also let the export contain date-search-based views if needed commit | commitdiff | tree Andreas Unterkircher [Sat, 14 Jul 2007 13:53:24 +0000 (13:53 +0000)] issue27, also let the export contain date-search-based views if needed git-svn-id: file:///var/lib/svn/phpfspot/trunk@203 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue13, all external links have been tested again, single photo, with tag- or date... commit | commitdiff | tree Andreas Unterkircher [Sat, 14 Jul 2007 13:47:10 +0000 (13:47 +0000)] issue13, all external links have been tested again, single photo, with tag- or date-search are now possible git-svn-id: file:///var/lib/svn/phpfspot/trunk@202 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue42, reset-all is now also refreshing the views commit | commitdiff | tree Andreas Unterkircher [Sat, 14 Jul 2007 12:53:14 +0000 (12:53 +0000)] issue42, reset-all is now also refreshing the views git-svn-id: file:///var/lib/svn/phpfspot/trunk@201 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agosome style improvements commit | commitdiff | tree Andreas Unterkircher [Sat, 14 Jul 2007 12:44:13 +0000 (12:44 +0000)] some style improvements git-svn-id: file:///var/lib/svn/phpfspot/trunk@200 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue27, remove any value from tag-search-input-valid when date search is invoked... commit | commitdiff | tree Andreas Unterkircher [Sat, 14 Jul 2007 12:27:40 +0000 (12:27 +0000)] issue27, remove any value from tag-search-input-valid when date search is invoked to avoid user-confusion git-svn-id: file:///var/lib/svn/phpfspot/trunk@199 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue24, first trial of date search is now included commit | commitdiff | tree Andreas Unterkircher [Sat, 14 Jul 2007 12:06:42 +0000 (12:06 +0000)] issue24, first trial of date search is now included git-svn-id: file:///var/lib/svn/phpfspot/trunk@198 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agochanging primary font to Verdana commit | commitdiff | tree Andreas Unterkircher [Sat, 14 Jul 2007 08:31:45 +0000 (08:31 +0000)] changing primary font to Verdana git-svn-id: file:///var/lib/svn/phpfspot/trunk@197 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue41, remove any trace of the javascript bubble commit | commitdiff | tree Andreas Unterkircher [Sat, 14 Jul 2007 06:33:18 +0000 (06:33 +0000)] issue41, remove any trace of the javascript bubble git-svn-id: file:///var/lib/svn/phpfspot/trunk@196 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue27, on gallery export use links which will guide back the user into phpfspot... commit | commitdiff | tree Andreas Unterkircher [Sat, 14 Jul 2007 06:27:20 +0000 (06:27 +0000)] issue27, on gallery export use links which will guide back the user into phpfspot instead directly open the image with phpfspot_img.php git-svn-id: file:///var/lib/svn/phpfspot/trunk@195 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue39, check if all necessary config params are set commit | commitdiff | tree Andreas Unterkircher [Fri, 13 Jul 2007 05:53:30 +0000 (05:53 +0000)] issue39, check if all necessary config params are set git-svn-id: file:///var/lib/svn/phpfspot/trunk@194 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue40, some identitity note at the bottom of the page commit | commitdiff | tree Andreas Unterkircher [Fri, 13 Jul 2007 04:10:50 +0000 (04:10 +0000)] issue40, some identitity note at the bottom of the page git-svn-id: file:///var/lib/svn/phpfspot/trunk@193 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue13, added first try of external link to directly jump to a photo commit | commitdiff | tree Andreas Unterkircher [Thu, 12 Jul 2007 17:36:34 +0000 (17:36 +0000)] issue13, added first try of external link to directly jump to a photo git-svn-id: file:///var/lib/svn/phpfspot/trunk@192 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue27, added a nice export icon commit | commitdiff | tree Andreas Unterkircher [Wed, 11 Jul 2007 17:49:01 +0000 (17:49 +0000)] issue27, added a nice export icon git-svn-id: file:///var/lib/svn/phpfspot/trunk@191 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoimproved the welcome text commit | commitdiff | tree Andreas Unterkircher [Wed, 11 Jul 2007 17:00:51 +0000 (17:00 +0000)] improved the welcome text git-svn-id: file:///var/lib/svn/phpfspot/trunk@190 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoimprove moinmoin url syntax so thumbnails are correctly detected as images commit | commitdiff | tree Fabian Linzberger [Wed, 11 Jul 2007 07:00:14 +0000 (07:00 +0000)] improve moinmoin url syntax so thumbnails are correctly detected as images git-svn-id: file:///var/lib/svn/phpfspot/trunk@189 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue29, when the mouse keeps staying over the link, show also the full photo name commit | commitdiff | tree Andreas Unterkircher [Tue, 10 Jul 2007 19:01:36 +0000 (19:01 +0000)] issue29, when the mouse keeps staying over the link, show also the full photo name git-svn-id: file:///var/lib/svn/phpfspot/trunk@188 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue27, template for gallery export commit | commitdiff | tree Andreas Unterkircher [Tue, 10 Jul 2007 18:52:56 +0000 (18:52 +0000)] issue27, template for gallery export git-svn-id: file:///var/lib/svn/phpfspot/trunk@187 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue13, fixed external link - the browser will complete them commit | commitdiff | tree Andreas Unterkircher [Tue, 10 Jul 2007 18:52:17 +0000 (18:52 +0000)] issue13, fixed external link - the browser will complete them git-svn-id: file:///var/lib/svn/phpfspot/trunk@186 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue27, first trial of gallery export for HTML and MoinMoin markup commit | commitdiff | tree Andreas Unterkircher [Tue, 10 Jul 2007 18:48:41 +0000 (18:48 +0000)] issue27, first trial of gallery export for HTML and MoinMoin markup git-svn-id: file:///var/lib/svn/phpfspot/trunk@185 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue38, removed pending comma on last selected-tag entry commit | commitdiff | tree Andreas Unterkircher [Tue, 10 Jul 2007 17:24:16 +0000 (17:24 +0000)] issue38, removed pending comma on last selected-tag entry git-svn-id: file:///var/lib/svn/phpfspot/trunk@184 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue35, if too many tags are selected and AND condition is used, this will show... commit | commitdiff | tree Andreas Unterkircher [Sun, 8 Jul 2007 13:04:44 +0000 (13:04 +0000)] issue35, if too many tags are selected and AND condition is used, this will show up a warning now git-svn-id: file:///var/lib/svn/phpfspot/trunk@183 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue34, fixed wickeld tag column when too many tags are selected commit | commitdiff | tree Andreas Unterkircher [Sun, 8 Jul 2007 12:52:24 +0000 (12:52 +0000)] issue34, fixed wickeld tag column when too many tags are selected git-svn-id: file:///var/lib/svn/phpfspot/trunk@182 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue33, fixed nasty IE viewing page selectors wrong commit | commitdiff | tree Andreas Unterkircher [Sun, 8 Jul 2007 12:39:33 +0000 (12:39 +0000)] issue33, fixed nasty IE viewing page selectors wrong git-svn-id: file:///var/lib/svn/phpfspot/trunk@181 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue32, hide navigation photo if user tag-selection result in empty view commit | commitdiff | tree Andreas Unterkircher [Sun, 8 Jul 2007 12:30:46 +0000 (12:30 +0000)] issue32, hide navigation photo if user tag-selection result in empty view git-svn-id: file:///var/lib/svn/phpfspot/trunk@180 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue6, improved page selector commit | commitdiff | tree Andreas Unterkircher [Sun, 8 Jul 2007 12:09:02 +0000 (12:09 +0000)] issue6, improved page selector git-svn-id: file:///var/lib/svn/phpfspot/trunk@179 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoplace a horiz. line between photo details and preview pictures commit | commitdiff | tree Andreas Unterkircher [Sun, 8 Jul 2007 09:13:32 +0000 (09:13 +0000)] place a horiz. line between photo details and preview pictures git-svn-id: file:///var/lib/svn/phpfspot/trunk@178 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue31, added a nice icon for the photo preview in single photo view commit | commitdiff | tree Andreas Unterkircher [Sat, 7 Jul 2007 10:07:57 +0000 (10:07 +0000)] issue31, added a nice icon for the photo preview in single photo view git-svn-id: file:///var/lib/svn/phpfspot/trunk@177 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoremoved information icon - more or less useless commit | commitdiff | tree Andreas Unterkircher [Sat, 7 Jul 2007 10:02:55 +0000 (10:02 +0000)] removed information icon - more or less useless git-svn-id: file:///var/lib/svn/phpfspot/trunk@176 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue31, a mini preview of the previous and next photo is now shown in a single photo... commit | commitdiff | tree Andreas Unterkircher [Sat, 7 Jul 2007 09:50:07 +0000 (09:50 +0000)] issue31, a mini preview of the previous and next photo is now shown in a single photo view git-svn-id: file:///var/lib/svn/phpfspot/trunk@175 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agosome code for issue24 commit | commitdiff | tree Andreas Unterkircher [Sat, 7 Jul 2007 09:39:24 +0000 (09:39 +0000)] some code for issue24 git-svn-id: file:///var/lib/svn/phpfspot/trunk@174 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue28, use getimagesize if no exif data is available commit | commitdiff | tree Andreas Unterkircher [Sat, 7 Jul 2007 09:36:08 +0000 (09:36 +0000)] issue28, use getimagesize if no exif data is available git-svn-id: file:///var/lib/svn/phpfspot/trunk@173 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue24, seperated search functions into their own template commit | commitdiff | tree Andreas Unterkircher [Sat, 7 Jul 2007 09:32:33 +0000 (09:32 +0000)] issue24, seperated search functions into their own template git-svn-id: file:///var/lib/svn/phpfspot/trunk@172 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue24, some stylesheet changes commit | commitdiff | tree Andreas Unterkircher [Sat, 7 Jul 2007 09:31:20 +0000 (09:31 +0000)] issue24, some stylesheet changes git-svn-id: file:///var/lib/svn/phpfspot/trunk@171 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue24, some html changes so the left column can be handled as general "option"... commit | commitdiff | tree Andreas Unterkircher [Sat, 7 Jul 2007 09:26:10 +0000 (09:26 +0000)] issue24, some html changes so the left column can be handled as general "option" column which include search, tags, ... git-svn-id: file:///var/lib/svn/phpfspot/trunk@170 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoblur the focus on mouse click commit | commitdiff | tree Andreas Unterkircher [Sat, 7 Jul 2007 07:38:24 +0000 (07:38 +0000)] blur the focus on mouse click git-svn-id: file:///var/lib/svn/phpfspot/trunk@169 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue27, beginning implementation commit | commitdiff | tree Andreas Unterkircher [Fri, 6 Jul 2007 18:03:49 +0000 (18:03 +0000)] issue27, beginning implementation git-svn-id: file:///var/lib/svn/phpfspot/trunk@168 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue29, shorten too long names commit | commitdiff | tree Andreas Unterkircher [Fri, 6 Jul 2007 17:01:45 +0000 (17:01 +0000)] issue29, shorten too long names git-svn-id: file:///var/lib/svn/phpfspot/trunk@167 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue21, reordered photo index and added some nice mouseover effect commit | commitdiff | tree Andreas Unterkircher [Fri, 6 Jul 2007 16:53:10 +0000 (16:53 +0000)] issue21, reordered photo index and added some nice mouseover effect git-svn-id: file:///var/lib/svn/phpfspot/trunk@166 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue22, vertical images should now get resized correctly also if the rotation is... commit | commitdiff | tree Andreas Unterkircher [Fri, 6 Jul 2007 06:13:12 +0000 (06:13 +0000)] issue22, vertical images should now get resized correctly also if the rotation is specified via EXIF orientation. git-svn-id: file:///var/lib/svn/phpfspot/trunk@165 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue13, now using a nice link icon commit | commitdiff | tree Andreas Unterkircher [Thu, 5 Jul 2007 16:29:40 +0000 (16:29 +0000)] issue13, now using a nice link icon git-svn-id: file:///var/lib/svn/phpfspot/trunk@164 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoalso show a hint that the photo index can be displayed by commit | commitdiff | tree Andreas Unterkircher [Thu, 5 Jul 2007 04:15:22 +0000 (04:15 +0000)] also show a hint that the photo index can be displayed by selecting a tag from the tag-list git-svn-id: file:///var/lib/svn/phpfspot/trunk@163 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue13, if user jumps into from an external link, immediatley display the photo... commit | commitdiff | tree Andreas Unterkircher [Wed, 4 Jul 2007 19:02:47 +0000 (19:02 +0000)] issue13, if user jumps into from an external link, immediatley display the photo index according the tag selection provided git-svn-id: file:///var/lib/svn/phpfspot/trunk@162 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue26, added some mouseover text which will explain buttons functions commit | commitdiff | tree Andreas Unterkircher [Wed, 4 Jul 2007 18:45:12 +0000 (18:45 +0000)] issue26, added some mouseover text which will explain buttons functions git-svn-id: file:///var/lib/svn/phpfspot/trunk@161 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue26, new icon commit | commitdiff | tree Andreas Unterkircher [Wed, 4 Jul 2007 18:44:40 +0000 (18:44 +0000)] issue26, new icon git-svn-id: file:///var/lib/svn/phpfspot/trunk@160 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoset a startup variable. unset it with the first call of the photo index page commit | commitdiff | tree Andreas Unterkircher [Wed, 4 Jul 2007 18:32:50 +0000 (18:32 +0000)] set a startup variable. unset it with the first call of the photo index page git-svn-id: file:///var/lib/svn/phpfspot/trunk@159 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoonly set anchor is it is really provided by the client commit | commitdiff | tree Andreas Unterkircher [Sun, 1 Jul 2007 17:29:21 +0000 (17:29 +0000)] only set anchor is it is really provided by the client git-svn-id: file:///var/lib/svn/phpfspot/trunk@158 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue22, vertical images are now getting resized correctly commit | commitdiff | tree Andreas Unterkircher [Sun, 1 Jul 2007 15:43:15 +0000 (15:43 +0000)] issue22, vertical images are now getting resized correctly git-svn-id: file:///var/lib/svn/phpfspot/trunk@157 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue20, use <a>-anchor to directly jump to the right photo in photo index view commit | commitdiff | tree Andreas Unterkircher [Sun, 1 Jul 2007 11:58:41 +0000 (11:58 +0000)] issue20, use <a>-anchor to directly jump to the right photo in photo index view git-svn-id: file:///var/lib/svn/phpfspot/trunk@156 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue20, jumping back to the right multipage is now possible commit | commitdiff | tree Andreas Unterkircher [Sun, 1 Jul 2007 10:12:10 +0000 (10:12 +0000)] issue20, jumping back to the right multipage is now possible git-svn-id: file:///var/lib/svn/phpfspot/trunk@155 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue6, only show page selector if more then one page commit | commitdiff | tree Andreas Unterkircher [Sun, 1 Jul 2007 09:13:27 +0000 (09:13 +0000)] issue6, only show page selector if more then one page git-svn-id: file:///var/lib/svn/phpfspot/trunk@154 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoinstead of empty cells, show now grayed icons if first or last object reached commit | commitdiff | tree Andreas Unterkircher [Sun, 1 Jul 2007 09:09:58 +0000 (09:09 +0000)] instead of empty cells, show now grayed icons if first or last object reached git-svn-id: file:///var/lib/svn/phpfspot/trunk@153 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue6, page selector - a first try commit | commitdiff | tree Andreas Unterkircher [Sun, 1 Jul 2007 09:04:03 +0000 (09:04 +0000)] issue6, page selector - a first try git-svn-id: file:///var/lib/svn/phpfspot/trunk@152 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue19, if no exif data is available, show "n/a" instead of empty cells commit | commitdiff | tree Andreas Unterkircher [Sun, 1 Jul 2007 05:45:25 +0000 (05:45 +0000)] issue19, if no exif data is available, show "n/a" instead of empty cells git-svn-id: file:///var/lib/svn/phpfspot/trunk@151 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoremove unity from template, its now provided via php script commit | commitdiff | tree Andreas Unterkircher [Sun, 1 Jul 2007 05:44:15 +0000 (05:44 +0000)] remove unity from template, its now provided via php script git-svn-id: file:///var/lib/svn/phpfspot/trunk@150 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agobeautify some warning messages commit | commitdiff | tree Andreas Unterkircher [Sun, 1 Jul 2007 05:32:04 +0000 (05:32 +0000)] beautify some warning messages git-svn-id: file:///var/lib/svn/phpfspot/trunk@149 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agocheck if photo exists and is readable in gen_thumb() function also commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 10:32:25 +0000 (10:32 +0000)] check if photo exists and is readable in gen_thumb() function also git-svn-id: file:///var/lib/svn/phpfspot/trunk@148 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoremoved temp text and inserted a much better text into commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 10:21:29 +0000 (10:21 +0000)] removed temp text and inserted a much better text into git-svn-id: file:///var/lib/svn/phpfspot/trunk@147 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agofixed syntax error commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 10:00:48 +0000 (10:00 +0000)] fixed syntax error git-svn-id: file:///var/lib/svn/phpfspot/trunk@146 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agomake sure gen_thumbs can only be invoked from command line and not via the browser commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 09:59:43 +0000 (09:59 +0000)] make sure gen_thumbs can only be invoked from command line and not via the browser git-svn-id: file:///var/lib/svn/phpfspot/trunk@145 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoalso display an little icon near the "pic is also listed in the following tags" commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 09:49:12 +0000 (09:49 +0000)] also display an little icon near the "pic is also listed in the following tags" git-svn-id: file:///var/lib/svn/phpfspot/trunk@144 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoadded a smaller version fo the available-tags icon for the photo details commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 09:47:37 +0000 (09:47 +0000)] added a smaller version fo the available-tags icon for the photo details git-svn-id: file:///var/lib/svn/phpfspot/trunk@143 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue18, invoke clearSearch on reset commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 09:37:44 +0000 (09:37 +0000)] issue18, invoke clearSearch on reset git-svn-id: file:///var/lib/svn/phpfspot/trunk@142 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue15, check for compatible image type commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 09:34:00 +0000 (09:34 +0000)] issue15, check for compatible image type git-svn-id: file:///var/lib/svn/phpfspot/trunk@141 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agofavicon commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 08:21:21 +0000 (08:21 +0000)] favicon git-svn-id: file:///var/lib/svn/phpfspot/trunk@140 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoon reset also reset tag search result commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 07:59:38 +0000 (07:59 +0000)] on reset also reset tag search result git-svn-id: file:///var/lib/svn/phpfspot/trunk@139 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoavoid error messages if $_SESSION['selected_tags'] is set with an empty value in... commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 07:52:11 +0000 (07:52 +0000)] avoid error messages if $_SESSION['selected_tags'] is set with an empty value in photo index view git-svn-id: file:///var/lib/svn/phpfspot/trunk@138 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoensure the browser does not wrap the photo index title text commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 07:36:23 +0000 (07:36 +0000)] ensure the browser does not wrap the photo index title text git-svn-id: file:///var/lib/svn/phpfspot/trunk@137 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agouse ignore_once instead of ignore for requirement checks, or rpc.php will fail becaus... commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 07:33:50 +0000 (07:33 +0000)] use ignore_once instead of ignore for requirement checks, or rpc.php will fail because HTML_AJAX get redeclared git-svn-id: file:///var/lib/svn/phpfspot/trunk@136 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agomove phpfspot cfg in a dist-config. ignore phpfspot_cfg.php from now commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 07:27:05 +0000 (07:27 +0000)] move phpfspot cfg in a dist-config. ignore phpfspot_cfg.php from now git-svn-id: file:///var/lib/svn/phpfspot/trunk@135 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agosome cleanup in gen_thumb code commit | commitdiff | tree Andreas Unterkircher [Sat, 30 Jun 2007 07:26:00 +0000 (07:26 +0000)] some cleanup in gen_thumb code git-svn-id: file:///var/lib/svn/phpfspot/trunk@134 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agothis software does not have any MySQL requirements commit | commitdiff | tree Andreas Unterkircher [Fri, 29 Jun 2007 17:47:51 +0000 (17:47 +0000)] this software does not have any MySQL requirements git-svn-id: file:///var/lib/svn/phpfspot/trunk@133 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue3, first requirement checks commit | commitdiff | tree Andreas Unterkircher [Fri, 29 Jun 2007 17:46:43 +0000 (17:46 +0000)] issue3, first requirement checks git-svn-id: file:///var/lib/svn/phpfspot/trunk@132 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue17, add a "Loading" text when tags-list getting loaded commit | commitdiff | tree Andreas Unterkircher [Mon, 25 Jun 2007 18:30:30 +0000 (18:30 +0000)] issue17, add a "Loading" text when tags-list getting loaded git-svn-id: file:///var/lib/svn/phpfspot/trunk@131 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agosome style improvements on photo view commit | commitdiff | tree Andreas Unterkircher [Mon, 25 Jun 2007 18:22:29 +0000 (18:22 +0000)] some style improvements on photo view git-svn-id: file:///var/lib/svn/phpfspot/trunk@130 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agoissue13, first try of external links, this time for photo index commit | commitdiff | tree Andreas Unterkircher [Sun, 24 Jun 2007 18:08:49 +0000 (18:08 +0000)] issue13, first try of external links, this time for photo index git-svn-id: file:///var/lib/svn/phpfspot/trunk@129 fa6a889d-dae6-447d-9e79-4ba9a3039384 15 years agolimit line-height in tags-listing commit | commitdiff | tree Andreas Unterkircher [Sun, 24 Jun 2007 18:08:06 +0000 (18:08 +0000)] limit line-height in tags-listing git-svn-id: file:///var/lib/svn/phpfspot/trunk@128 fa6a889d-dae6-447d-9e79-4ba9a3039384 next private clone + local modifications of http://git.netshadow.at/phpfspot.git/ RSS Atom | negative |
The Barca chief was interpreted by some as suggesting the legal proceedings are the late coach's fault, but he insists his words have been twisted
Josep Maria Bartomeu has hit out at those who have suggested he was blaming the Neymar tax case on deceased former Barcelona coach Tito Vilanova.
The Barca president is facing a potential prison sentence if found guilty of misdemeanours with regards to the financial aspect of Neymar's transfer in 2013 and a video of Bartomeu addressing public prosecutor Judge Ruz emerged on Friday showing him saying it was Vilanova's idea to bring forward the move by a year.
That led to claims Bartomeu was pinning the blame on the coach, who died of cancer in April 2014, but the Barca supremo is claiming his words have been twisted from their original intentions.
"It's a wrong interpretation to say I was blaming Tito," he said. "I don't like people playing with Vilanova's name. I'm disappointed and we are against those who want to tarnish his reputation.
"Sandro Rosell carried out the signing as he was the most known in Brazil. The coach asked us to make sign him as soon as possible and that is how we could sign Neymar one season before.
"Tito is not responsible of anything, just of bringing Neymar to Barca. And that is great, as we are pleased the player is here."
The quotes Bartomeu was referring to were spoken at a hearing in February and Cadena Ser published a video of the Barca chief's explanation.
"We spoke to our coach, who at that time was Tito Vilanova, and he asked me and the then president Sandro Rosell if we could bring forward the signing of Neymar by one year as he felt that the team needed a player with his characteristics," Bartomeu said in legal proceedings with Judge Ruz.
"He wanted to make the signing in 2013 instead of bringing him over in the summer of 2014. The plan was for Neymar to finish the World Cup in Brazil and then move to Barcelona but we wanted to carry out the wishes of the coach.
"Rosell, had a good relationship with his father, spoke to him and we saw how they’d forged a deal to bring him to Barcelona a year ahead of what was originally scheduled.
"The coaches don’t get involved in the price of players. He told us that he only had one match-changing player and wasn’t interested in keeping David Villa. He wanted Villa to leave and that we'd sign Neymar as a striker.
"If Neymar coming wasn’t realistic we’d stick with David Villa who had another year left to run on his contract. We understood the needs of the coach; this happened in New York in February 2013."
Bartomeu then went on to reveal that Rosell was the one who eventually made the deal happen, stressing he did not play any role in the transfer.
"In this case as it was a Brazilian player and, as Sandro had lived there, he knew the market well, so it was Sandro Rosell who dealt in all negotiation with Neymar’s father.
"Did I get involved with any negotiation with Santos or Neymar’s father? No, no. At no point." | positive |
Talk about a "damned if you do, damned if you don't" situation. The U.S. needs to generate more renewable energy if we hope to stave off the effects of climate change. At the same time, critically endangered California condors (Gymnogyps californianus)—which today number 417 birds after the last 22 members of their species were put in a captive breeding program in 1987—need more room to fly and breed as well as more chances to not die. Are these two goals at odds with each other? Many conservationists, who treasure the massive vultures with three-meter wingspans, say yes. The government last week said no.
Here's the situation: The U.S. Bureau of Land Management (BLM) last week approved a 153-megawatt wind farm, the Alta East Wind Project, in southern California relatively close to where the condors have regained some of their historic habitat. (The birds have also been released in parts of Utah and Arizona.) The project's parent company, Terra–Gen Power, worked with the BLM and the U.S. Fish and Wildlife Service (FWS) to see how the 1,049-hectare wind farm—most of which will be built on federal land—would be compatible with the big birds. Terra–Gen halved the number of planned turbines and agreed to install what has been called a "comprehensive condor detection and avoidance" system that would slow down and then turn off the turbines if condors came too close. The company also agreed to contribute $100,000 a year to the Condor Recovery Program, and it will also fund a program to help abate lead in the area. (We'll get back to the lead issue in a bit.)
So with those promises and technologies in place, the FWS made a decision: the Alta East Wind Project has been granted a license to "take"—yes, that means kill—a single California condor over the course of the wind farm's projected 30-year life span. This doesn't mean they will kill a condor, only that they have permission if a fatality occurs. Killing an endangered species usually results in fines ($200,000 for corporations) or even jail time for individuals, neither of which the company would face if a condor dies as a result of the wind farm.
This is not a blank check. If a condor is killed by the turbines, the company will need to further adapt its operations and turn the turbines off during the day when the condors are most active. It will also be required to take further, undisclosed "additional measures to ensure that the project does not pose any threats to condors," according to a BLM press release. Although no dollar values have been assigned to those actions, they would no doubt significantly cut down on the wind farm's generating capacity and its profits.
FWS biologists say the likelihood of a condor being killed by the wind farm is low, as the location is outside of the birds' historic range. The area, in the Tehachapi Mountains 160 kilometers north of Los Angeles, also lacks the thermal updrafts the massive birds use to fly. Meanwhile, each condor that has been released back into the wild carries a radio transmitter that the wind farm's avoidance system will reportedly be able to detect from up to 25 kilometers away, theoretically providing enough time to turn the turbines off if the birds get too close.
The American Bird Conservancy (ABC) had one of the most critical responses to the BLM–FWS decision, pointing out that numerous private organizations have contributed a lot of time and money to help save the condor from extinction. "This [California condor] recovery effort has cost millions of dollars and been the life's work of many talented people," Kelly Fuller, ABC's Wind Campaign coordinator, said in a press release. "The Department of Interior [under which both the BLM and FWS fall] has signaled today that it is willing to sacrifice the money and hard work that are spent on private conservation efforts to recover endangered species in order to build wind farms. ABC is extremely concerned about the negative effects that this decision could have not only on the condor recovery program, but also on other recovery programs that rely on public–private partnerships, such as for whooping cranes."
Lisa Belenky, senior attorney with the Center for Biological Diversity (CBD), told Politico that she worries that condor populations are still too small (currently 240 birds in the wild, with the rest in captivity) to risk even a single death. She also worried about setting a precedent. "There could be two; there could be five. I mean, where is the number that would be too many?"
Outside of wind power the more pressing threat to condors remains lead, to which they are particularly susceptible. Condors, as scavengers, eat carcasses or gut piles left behind by hunters, often ingesting lead-bullet fragments as they dine. California banned the use of most lead ammunition in condor habitats back in 2007 but it remains legal in other parts of California as well as in Utah and Arizona. Four of the eight wild condors that died in Arizona and Utah in 2012 died from lead poisoning, according to a recent report from The Peregrine Fund. At least one condor has already died this year from lead toxicosis; seven other deaths in 2013 were from as-yet-unknown causes. The CBD has an active "Get the Lead Out" campaign trying to ban more lead ammo in the condors' range. The CBD and the National Rifle Association, which opposes the ban, argued their sides of the case in federal court last week.
No matter which side of the wind farm debate you fall on, the truth about this case is that it illustrates how even sustainable energies have some impact somewhere. Energy scientists often say "there is no free lunch." Wind turbines sometimes kill birds and solar projects can displace endangered species such as tortoises. Of course, that pales in comparison with fossil fuels, which can drastically affect wildlife in the areas around production and distribution, along with the climate on a global scale. With California predicted to be the next oil-boom state, maybe wind poses the lesser threat to the condors and other wildlife in the region.
Photo by Thomas Cantwell. Used under Creative Commons license
Previously in Extinction Countdown: | positive |
CLOSE Suburban Chicago attorney Kathleen Zellner has vowed to use advances in scientific technology to prove that Steven Avery was wrongfully convicted of the Oct. 31, 2005 slaying of photographer Teresa Halbach. USA TODAY NETWORK-Wisconsin
Buy Photo Steven Avery attorney Kathleen Zellner speaks in front of the Manitowoc County Courthouse Friday August 26, 2016 in Manitowoc. (Photo: Gary C. Klein/USA TODAY NETWORK-Wisconsin)Buy Photo
MANITOWOC - There was no media hoopla on Wednesday when attorney Kathleen Zellner showed up at the Manitowoc County courthouse to file five binders of documents on behalf of convicted killer Steven Avery.
Zellner's much-anticipated post-conviction motion filing — more than 1,250 pages in length — lays out her arguments and theories surrounding the death of Teresa Halbach.
The Wisconsin Department of Justice told USA TODAY NETWORK-Wisconsin that Avery's motion for a new trial is without merit.
"We are confident that as with Mr. Avery's prior motions, this one also is without merit and will be rejected once it is considered by the court," said Rebecca Ballweg, senior communications specialist in the state Attorney General's office. "We continue to send our condolences to the Halbach family as they have to endure Avery's ridiculous attempts to re-litigate his guilty verdict and sentence."
The motion filed on behalf of Avery, who turns 55 next month, won't be resolved overnight. It will likely take a number of months before Sheboygan County Judge Angela Sutkiewicz issues a ruling.
RELATED: Avery's lawyer Kathleen Zellner comes under scrutiny
RELATED: Dassey case stirs national debate on confessions
Here are some of the key revelations and accusations that Zellner laid out as part of her quest to prove that her client was wrongfully convicted of murder:
1. Criticizes the previous criminal defense work of Avery's original trial lawyers, Jerry Buting and Dean Strang.
Zellner's voluminous filing accuses the two prominent Wisconsin attorneys of shoddy work after Avery hired them for $220,000 after being charged with Halbach's murder in 2005. "Trial defense counsel failed to thoroughly investigate other suspects and instead chose a scattergun approach of simply naming individuals without meeting the requirements of State V. Denny (a third-party alternative defense). Trial defense counsel also failed to utilize available evidence which confirmed that the (victim's) vehicle was moved onto the Avery property after Ms. Halbach was killed elsewhere."
Strang and Buting addressed Zellner's post-conviction motion in an email Thursday to USA TODAY NETWORK-Wisconsin.
“We have not read Kathleen Zellner’s June 7, 2017, filings for Steven Avery in their entirety, but have read the 202-page motion itself," the attorneys said. "We are glad that she has filed a motion with supporting documents. What really matters here, to us and we hope to everyone, is that we get closer to the truth in this case and to justice for everyone. We hope that Ms. Zellner, and Steven Avery’s entire current legal team, have taken an important step yesterday toward those two, related goals.”
2. Maintains that Avery's 1996 blood vial that became the focus of Strang and Buting's evidence-planting trial defense was irrelevant and had nothing to do with the case. "Mr. Avery's Wisconsin Innocence Project attorneys broke the seal of the 1996 blood vial package and resealed the enclosed box using only a strip of Scotch tape. There was no credible proof presented to the jury establishing that Lt. (James) Lenk and Sgt. (Andrew) Colborn accessed the Clerk of Court's file to obtain Mr. Avery's blood to plant it in the RAV-4."
3. Suggests Avery's blood was planted inside the RAV4, but stated that the blood came from inside Avery's bathroom in his red trailer. According to Zellner, Avery broke open a cut on the middle finger of his right hand on Nov. 3, 2005. "Mr. Avery dripped blood onto the rim and basin of the sink and the bathroom floor ... He did not clean the blood out of his sink prior to leaving the trailer at approximately 7:30 p.m. to go to Menards with his brother Chuck." Avery got home around 10 p.m. and went straight to bed. The next morning, he entered his bathroom to shower, noticing "that most of the blood in and around the sink had been removed. Mr. Avery consistently expressed his belief to his attorneys and the media that the blood of his found in Ms. Halbach's vehicle was planted and that it came from his trailer."
4. Disputes the prosecution's claim that Halbach suffered gunshot wounds to her head and that her dead body was thrown into the cargo area of her vehicle. "The erroneous blood spatter testimony of the State's expert (Nick) Stahlke resulted in the State presenting a false narrative to the jury about the sequence of events surrounding the attack on Ms. Halbach." Stuart James, a renowned blood-spatter expert from Florida, conducted several experiments concluding Halbach "was struck on the head after she opened the rear cargo door. She fell to the ground next to the rear bumper on the driver's side where she was struck repeatedly by an object similar to a mallet or hammer."
5. Conducted experiments and demonstrations to prove Colborn and Lenk's trial testimony about finding the spare key inside Avery's bedroom was false. "Neither side subpoenaed Mr. Avery's bookcase to the trial. Trial defense counsel's failure to have the bookcase at trial to demonstrate the impossibility of the State's story about the discovery of the key was a fatal error. A simple experiment with the bookcase and Toyota key would have conclusively demonstrated that the key was planted next to the bookcase by Sgt. Colborn and Lt. Lenk. Conclusive proof that this one piece of evidence was planted would have collapsed the State's house of fabricated evidence."
6. Points to Halbach's residence in rural Calumet County as the source of the spare key that is suspected to have been planted. At the time, she lived there with Scott Bloedorn, a longtime friend and former classmate. "On Nov. 4, 2005, news media crews filmed the interior of the house Ms. Halbach shared with Mr. Bloedorn. While interviewing Mr. Bloedorn in the kitchen, news media filmed what appeared to be the RAV-4 sub-key and blue lanyard, which was next to the kitchen sink. It is indisputable that the key that was found in Mr. Avery's bedroom was Ms. Halbach's sub-key with a blue lanyard attached."
7. Offers testimony from DNA expert Dr. Karl Reich, of Illinois, to assert that Avery's DNA was planted by law enforcement onto the spare key. "Dr. Reich conducted experiments that demonstrate that the DNA on the sub-key found in Mr. Avery's bedroom is of much greater quantity than the amount of DNA Mr. Avery deposited on an exemplar sub-key by holding it in his hand for 12 minutes as a part of Dr. Reich's experiment. Specifically, Dr. Reich found that Mr. Avery deposited 10 times less DNA on the exemplar sub-key than what the Wisconsin State Crime Laboratory detected on the sub-key recovered from Mr. Avery's bedroom ... the only plausible explanation is that the DNA was planted on the key from another source of Mr. Avery's DNA."
8. Accuses Manitowoc County law enforcement of taking Avery's toothbrush from his bathroom and using that item to plant Avery's DNA onto the spare key for Halbach's vehicle. "Mr. Avery's toothbrush was taken by law enforcement and current post-conviction counsel's DNA experts' experiments have shown that rubbing a toothbrush on an exemplar sub-key would produce a comparable quantity of DNA ... The only plausible explanation for the missing toothbrush was that law enforcement removed the toothbrush but never logged it into evidence so that it could be rubbed on the sub-key of Ms. Halbach."
9. Casts a cloud of suspicion on lead investigators Mark Wiegert of Calumet County and Tom Fassbender of the Wisconsin Department of Justice Division of Criminal Investigation. The two are accused of violating Avery's Fourth Amendment rights by exceeding the scope of a search warrant to obtain illegal samples of Avery's DNA for evidence planting purposes. "Two groin swabs were taken from Mr. Avery at Aurora Medical Center by a nurse on Nov. 9, 2005 ... Nurse (Faye) Fritsch would never have taken the groin swabs without being specifically instructed to do so by Agent Fassbender and Inv. Wiegert. Agent Fassbender and Inv. Wiegert's explanation that they did not realize that the search warrant did not call for taking groin swabs is not credible ... It is a reasonable probability that they intended to plant DNA from the groin swabs and conceal, from the official medical report, that groin swabs were taken. Inv. Wiegert clearly fabricated the chain of custody form given to Wisconsin State Crime Laboratory. In light of the new scientific testing done on the hood latch, Inv. Wiegert substituted the groin swabs for the hood latch swabs collected (in April 2006) by Sgt. (Bill) Tyson."
10. Accuses Halbach's ex-boyfriend, Ryan Hillegas, formerly of Hilbert, of being the real killer. According to court filings, Zellner uncovered evidence that Hillegas had had an abusive relationship with Halbach. "Before Ms. Halbach's murder, the killer most likely became aware that she was sexually involved with a married man and a second male who was a very close friend of the killer's," Zellner stated on page 98 of her legal brief. "The killer, who knew the password to her voice mailbox, deleted several of Ms. Halbach's voice messages to buy himself time before Teresa's family and friends realized that she was missing and began searching for her ... The killer knew Ms. Halbach very well in order to know her password. Clearly, this person was not Mr. Avery ... The killer wanted to control the investigation and direct it towards the single goal of framing Mr. Avery for the murder."
John Ferak of USA TODAY NETWORK-Wisconsin: 920-993-7115 or [email protected]; on Twitter @johnferak; Andy Thompson: 920-996-7270 or [email protected]; on Twitter @Thompson_AW
Read or Share this story: http://post.cr/2s8Qe52 | positive |
Recurrent UTIs linked to gut microbiome, chronic inflammation – Washington University School of Medicine in St. Louis - Topfitness20 Thursday, July 21 2022 Breaking News Democrats shape health care argument Georgia’s Nakobe Dean, Jordan Davis can transform Philadelphia Eagles’ defense – Philadelphia Eagles Blog AEW Rampage recap & reactions (May 6, 2022): Be afraid of Jay Lethal How serious is Russia about nuclear war? Langdon student Claire Hiltner to graduate with associate degree before high school graduation – Grand Forks Herald New USFL is only a few weeks old, but a union is already in the works Oil Profits Soar, but the Industry’s Path Forward Remains Uncertain North Korea fires likely submarine-launched ballistic missile, South Korea says SoulCycle Founders Start Peoplehood, With Workouts for the Self BenFred: It’s about time someone mentions the positives of all these late-starting Blues playoff games | Ben Frederickson Sidebar Random Article Log In Menu Topfitness20 Search for Home Business Entertainment Health Science Sports Technology World Terms and Conditions Privacy Policy Contact-Us Search for Home/Health/Recurrent UTIs linked to gut microbiome, chronic inflammation – Washington University School of Medicine in St. Louis Health Recurrent UTIs linked to gut microbiome, chronic inflammation – Washington University School of Medicine in St. Louis adminMay 2, 2022 0 0 4 minutes read Visit the News Hub Antibiotics may increase risk of further UTIs by disrupting microbiome Getty Images A study by researchers at Washington University School of Medicine in St. Louis and the Broad Institute of MIT and Harvard suggests that women who get recurrent urinary tract infections (UTIs) may be caught in a vicious cycle in which antibiotics given to eradicate one infection predispose them to develop another. One of the greatest frustrations regarding urinary tract infections (UTIs) is that they so often recur. UTIs are caused by bacteria in the urinary tract and characterized by frequent and painful urination. A round of antibiotics usually clears up the symptoms, but the relief is often temporary: A quarter of women go on to develop a second UTI within six months. Some unfortunate individuals get UTIs over and over, and require antibiotics every few months. A new study suggests that women who get recurrent UTIs may be caught in a vicious cycle in which antibiotics given to eradicate one infection predispose them to develop another. The study, by researchers at Washington University School of Medicine in St. Louis and the Broad Institute of MIT and Harvard, showed that a round of antibiotics eliminates disease-causing bacteria from the bladder but not from the intestines. Surviving bacteria in the gut can multiply and spread to the bladder again, causing another UTI. At the same time, repeated cycles of antibiotics wreak havoc on the community of helpful bacteria that normally live in the intestines, the so-called gut microbiome. Similar to other disorders in which gut microbes and the immune system are linked, women with recurrent UTIs in the study had less diverse microbiomes that were deficient in an important group of bacteria that helps regulate inflammation, and a distinct immunological signature in their blood indicative of inflammation. The study is published May 2 in Nature Microbiology. “It’s frustrating for women who are coming in to the doctor with recurrence after recurrence after recurrence, and the doctor, who’s typically male, gives them advice about hygiene,” said co-senior author Scott J. Hultgren, PhD, the Helen L. Stoever Professor of Molecular Microbiology at Washington University. “That’s not necessarily what the problem is. It’s not necessarily poor hygiene that’s causing this. The problem lies in the disease itself, in this connection between the gut and the bladder and levels of inflammation. Basically, physicians don’t know what to do with recurrent UTI. All they have is antibiotics, so they throw more antibiotics at the problem, which probably just makes things worse.” Most UTIs are caused by Escherichia coli (E. coli) bacteria from the intestines that get into the urinary tract. To understand why some women get infection after infection and others get one or none, Hultgren teamed up with Broad Institute scientists Ashlee Earl, PhD, the senior group leader for the Bacterial Genomics Group at Broad and the paper’s co-senior author, and Colin Worby , PhD, a computational biologist and the paper’s lead author. The researchers studied 15 women with histories of recurrent UTIs and 16 women without. All participants provided urine and blood samples at the start of the study and monthly stool samples. The team analyzed the bacterial composition in the stool samples, tested the urine for the presence of bacteria, and measured gene expression in blood samples. Over the course of a year, 24 UTIs occurred, all in participants with histories of repeated UTIs. When participants were diagnosed with a UTI, the team took additional urine, blood and stool samples. The difference between the women who got repeated UTIs and those who didn’t, surprisingly, didn’t come down to the kind of E. coli in their intestines or even the presence of E. coli in their bladders. Both groups carried E. coli strains in their guts capable of causing UTIs, and such strains occasionally spread to their bladders. The real difference was in the makeup of their gut microbiomes. Patients with repeat infections showed decreased diversity of healthy gut microbial species, which could provide more opportunities for disease-causing species to gain a foothold and multiply. Notably, the microbiomes of women with recurrent UTIs were particularly scarce in bacteria that produce butyrate, a short-chain fatty acid with anti-inflammatory effects. “We think that women in the control group were able to clear the bacteria from their bladders before they caused disease, and women with recurrent UTI were not, because of a distinct immune response to bacterial invasion of the bladder potentially mediated by the gut microbiome, Worby said. The findings highlight the importance of finding alternatives to antibiotics for treating UTIs. “Our study clearly demonstrates that antibiotics do not prevent future infections or clear UTI-causing strains from the gut, and they may even make recurrence more likely by keeping the microbiome in a disrupted state,” Worby said Hultgren has long worked on finding innovative therapies to eradicate disease-causing strains of E. coli from the body while sparing the rest of the bacterial community. His research by him forms the basis of an experimental drug based on the sugar mannoside and an investigational vaccine, both of which are being tested in people. Another strategy would be to rebalance the microbiome through fecal transplants, probiotic foods or other means. “This is one of the most common infections in the United States, if not the world,” Hultgren said. “A good percentage of these UTI patients go on to get these chronic recurrences, and it results in decreased quality of life. There is a real need to develop better therapeutics that break this vicious cycle.” Worby CJ, Schreiber HL, Straub TJ, van Dijk LR, Bronson RA, Olson BS, Pinkner JS, Obernuefemann CLP, Muñoz VL, Paharik AE, Walker BJ, Desjardins CA, Chou WC, Bergeron K, Chapman SB, Klim A, Manson AL, Hannan TJ, Hooton TM, Kau AL, Lai HH, Dodson KW, Hultgren SJ, Earl AM. Longitudinal multi-omics analyzes link gut microbiome dysbiosis with recurrent urinary tract infections in women. Nature Microbiology. May 2, 2022. DOI: 10.1038/s41564-022-01107-x This project was supported by the National Institute of Allergy and Infectious Diseases of the National Institutes of Health (NIH), grant number U19AI110818; the NIH Mucosal Immunology Studies Team Consortium, grant number U01AI095542; the NIH, grant numbers T32GM007067 and T32GM139774; and the Center for Women’s Infectious Disease Research at Washington University School of Medicine. Washington University School of Medicine‘s 1,700 faculty physicians also are the medical staff of Barnes–Jewish and St.Louis Children’s hospitals. The School of Medicine is a leader in medical research, teaching and patient care, and is currently No. 4 in research funding from the National Institutes of Health (NIH). Through its affiliations with Barnes-Jewish and St. Louis Children’s hospitals, the School of Medicine is linked to BJC HealthCare. adminMay 2, 2022 0 0 4 minutes read Facebook Twitter LinkedIn Tumblr Pinterest Reddit VKontakte Share via Email Print admin Website Related Articles The 7 Most Effective Exercises To Strengthen Weak Knees, Experts Say — Eat This Not That April 20, 2022 Online learning going away in Maryland, Virginia, D.C. schools April 30, 2022 Three extensive bills targeting children’s mental health win final passage May 4, 2022 A guide to fighting jet lag April 29, 2022 Leave a Reply Cancel reply Your email address will not be published. Required fields are marked * Comment * Name * Email * Website Save my name, email, and website in this browser for the next time I comment. Check Also Close Health Virtual mental health supports – Province of British Columbia May 2, 2022 Recent Posts How Natalie Portman Got So Buff For Thor: Love & Thunder April 24, 2022 How To Buy Series I Bonds May 6, 2022 Shailene Woodley steps out as it’s revealed she and Aaron Rodgers are ‘done’ once again April 26, 2022 Morals, mental health and modesty earn BTS a legion of fans April 20, 2022 Jennifer Connelly brings eldest son Kai Dugan and husband Paul Bettany to Top Gun: Maverick premiere May 5, 2022 © Copyright 2022, All Rights Reserved | Jannah Theme by TieLabs Facebook Twitter WhatsApp Telegram Back to top button Close Search for: Search Search Recent Posts Democrats shape health care argument Georgia’s Nakobe Dean, Jordan Davis can transform Philadelphia Eagles’ defense – Philadelphia Eagles Blog AEW Rampage recap & reactions (May 6, 2022): Be afraid of Jay Lethal How serious is Russia about nuclear war? Langdon student Claire Hiltner to graduate with associate degree before high school graduation – Grand Forks Herald Recent Comments No comments to show. Archives May 2022 April 2022 Categories Business Entertainment Health Science Sports Technology World Close Search for Close Log In Forget? Remember me Log In | negative |
10 Free Patterns for Crochet Slippers | Craftsy Cart LOG IN Browse Fabric Crafts Fabric Crafts COL1 Quilting Sewing Embroidery Yarn Crafts Yarn Crafts COL1 Knitting Crocheting Weaving + Spinning Food Food COL1 Cake Decorating Baking Cooking Art Art COL1 Drawing Painting Photography Paper Crafting Jewelry Making Living Living COL1 Home Decor Gardening Woodworking Writing Fitness Yoga Fun For Kids Resources Resources COL 1 Recipes Cake Decorating Cooking Baking COL 2 Patterns Sewing Quilting Knitting Crocheting Resources Patterns Patterns COL Crocheting Knitting Quilting Sewing Recipes Recipes COL Baking Cooking Cake Decorating Search for: Cart LOG IN Shop All Classes Shop All Classes Fabric Crafts Fabric Crafts COL1 Quilting Sewing Embroidery Yarn Crafts Yarn Crafts COL1 Knitting Crocheting Weaving + Spinning Food Food COL1 Cake Decorating Baking Cooking Art Art COL1 Drawing Painting Photography Paper Crafting Jewelry Making Living Living COL1 Home Decor Gardening Woodworking Writing Fitness Yoga Fun For Kids Resources Resources COL 1 Recipes Cake Decorating Cooking Baking COL 2 Patterns Sewing Quilting Knitting Crocheting Patterns Patterns COL Crocheting Knitting Quilting Sewing Recipes Recipes COL Baking Cooking Cake Decorating 7 Fun Patterns for Crochet Slippers February 23, 2016 By Kathryn Vercillo & filed under Crocheting Blog. If you’ve never slipped your feet into a pair of handcrafted crochet slippers, then you are really missing out. The comfort and coziness of crochet slippers can’t be beat. And of course there’s special satisfaction when you’ve crocheted them yourself. These FREE patterns for crochet slippers are exactly what you need. Photo via Crochet by Jennifer 1. Adult Chunky Slippers These slippers have the ultimate cozy texture made using a combination of post stitches. In fact, they are so comfy that they’ve been described as “squishy foot massagers.” They’re cute, too, so you’ll feel stylish as well as comfortable when you wear them around the house. Get the pattern. Photo via Luba Davies 2. Cappuccino Lady Slippers Make these crochet slippers in cotton yarn for a warm-weather option, or use wool yarn for a cozier pair. This pattern is designed in four sizes, and the designer shares what the sizes would be in five different countries, so almost anyone can use this pattern to make a great pair of crochet slippers. This is a quick crochet project that should take you no more than a few hours to complete. Get the pattern Photo via Jay’s Boutique 3. Girl’s Bow Strap Slippers The Jay’s Boutique crochet pattern store is filled with great crochet baby shoes, including a pair of baby flats that were the prototype for this pair of girl’s slippers. The designer explains that simply by changing the hook size and yarn choice, you can make slippers for different sizes. This particular pattern was made for an 8-year-old girl using a G hook and Aran weight yarn. The cute bow is the perfect detail for adorable crochet slippers that girls of any age should love! Get the pattern Photo via Janis Frank 4. Ribbed Crochet Slippers This easy ribbed crochet slippers pattern makes a great pair of house slippers for anyone. The floral design pictured here is intended for feminine folks, but if you leave off the flower then you have a terrific unisex design. The pattern comes with instructions for a range of children’s and adult sizes.Get the FREE pattern Photo via Hip Hop Crochet 5. The Morgan Lady’s Slippers The combination of the smart yarn choice, the rounded design, the wide strap and the button detail all make for a perfect crochet slipper pattern! The pattern uses all of the basic crochet stitches in a way that creates the right shaping for the shoe.Get the pattern Photo via Solstice Child 6. Easy Ladybug Slippers Crochet slippers are meant to be worn around the house so you get away with sporting all kinds of crazy designs. It can be a lot of fun to wear different costume-style crochet slippers, making yourself smile every time you put them on. These easy ladybug slippers are a perfect example of that kind of design.Get the pattern Photo via Shush Lander 7. Elf Slippers If ladybug slippers aren’t quite your style but you want to wear fun and funky slippers, perhaps this Elf Slippers pattern is better suited to you. This crochet pattern is for one size only, but the designer offers a second free pattern in the same style but a different size. Check the designer’s shop for additional cute crochet slipper patterns (although they aren’t all free). Get the pattern Tags: accessories, crochet, Socks Comments Click here to cancel reply. Name (required) Mail (required) (will not be published) Website Δ 27 Responses to “7 Fun Patterns for Crochet Slippers” ann blondin September 16th, 2022 would like free chunky slipper pattern please Reply Janet Casmaer April 12th, 2021 Hmmm…every “free pattern” I have tried to access was not yet uploaded. How long does it take to add a link to a web site? I’m glad I only paid $2.50 for my “Premium” membership. I could do better with Google… Reply Customer Service April 12th, 2021 Hi Janet. I am sorry that you are experiencing technical difficulties with the pattern. We are aware of the issue and working on a resolution to get this resolved as quickly as possible. We are uploading new content every day! Once the pattern that you are looking for is uploaded there will be a button just below the description that says, “Make it” or “Get the Pattern”. I apologize for the inconvenience, please check the link again towards the end of the month. Jean Craftsy Reply Ellen Wright March 20th, 2021 It seems pattern that is free you can’t access. This is from hats slippers etc. The same message is on the site . “I apologize we are still working on loading the content…….” I am not sure what is going on but Craftsy is not something I will be using in future. Every pattern I have tried to use is not accessible. I can go on the internet and get more FREE patterns Reply JoAnn Tirollo February 4th, 2021 I would like pattern for crochet slippers. Can’t seem to access. Reply Julie January 2nd, 2021 I would like the pattern for the chunky slippers please. Has it been loaded yet? Reply Customer Service January 7th, 2021 Hi Julie, I apologize but we are still working on loading content onto the site. Once the pattern that you are looking for is uploaded there will be a button just below the description that says, “Make it” or “Get the Pattern”. I apologize for the inconvenience, please check the link again towards the end of the month. If you have any additional questions, please email or contact Customer Service at 888-891-7203. Sincerely, Kate Craftsy Reply Patricia Ramirez January 2nd, 2021 Where are the free patterns for the crochet slippers????????? Reply Sharon Dixon December 31st, 2020 Love pattern for #1 Adult Chunky Slippers for my husband in long term care thank you Reply Laura December 9th, 2020 The Adult Chunky Slippers please. Reply Customer Service December 10th, 2020 Hello Laura, I apologize but we are still working on loading content onto the site. If a link or download is not working for you, please attempt your access again in a few weeks. If you have any other questions, please email or contact Customer Service at 888-891-7203. Sincerely, Lindsay Craftsy Reply [email protected] December 5th, 2020 The chunky adult slippers please:) Reply Hillary Thompson December 9th, 2020 The chunky adult slippers please!! Many thanks Reply Customer Service December 10th, 2020 Hello Hillary, I apologize but we are still working on loading content onto the site. If a link or download is not working for you, please attempt your access again in a few weeks. If you have any other questions, please email or contact Customer Service at 888-891-7203. Sincerely, Lindsay Craftsy Reply Linda Hays November 30th, 2020 Any idea when the slipper patterns will become available? Reply Kathy Harding November 29th, 2020 Would love the chunky slipper pattern as well please. Reply Customer Service December 3rd, 2020 Hello Kathy, I apologize but we are still working on loading content onto the site. If a link or download is not working for you, please attempt your access again in a few weeks. Thanks! Reply [email protected] March 15th, 2021 patterns 1 and 2 are not free And can you please make the link colour darker? The very pale blue does nor show up well on white screen Reply Mary November 13th, 2020 Waiting to see the Free Patterns. Can’t wait to try them all! Reply Customer Service November 13th, 2020 Hello Mary, Patterns are still getting added to the site. I apologize for the wait. Thank you. Reply Jana Chisholm November 10th, 2020 Looking for slipper patterns that cover ankle sizes child to adult Reply Sandi November 7th, 2020 looking for pattern for adult chunky slippers please Reply kelly whan November 1st, 2020 looking for pattern for adult chunky slippers Reply Peg M McCauley September 29th, 2020 I’m interested in a slipper pattern Reply Arlene Jurofsky September 23rd, 2020 How can one acquire the free patterns ? Reply Arlene Jurofsky September 23rd, 2020 How can one acquire the free patterns ? Reply Jenus October 11th, 2020 Free Adult Chunky Slippers pattern please. Reply Sign up for our newsletter. Stay connected to Craftsy experts. Email* Δ Making lives better through creativity Craftsy Facebook Craftsy Instagram Craftsy Pinterest Craftsy Youtube Craftsy Twitter Popular Categories Quilt Knit Sew Crochet Embroider Cake Decorating Bake Cook Popular Projects Coffee-Shop Cakes Quick Quilted Gifts Fair Isle Fundamentals Sewing Wallets Crochet in the Round Asian Dumplings Thank-You Cards All FREE Classes LIVE Streaming Events FREE LIVE Tutorials Craftsy Chats Premium LIVE Events Virtual Events Customer Service About Us Contact Us Frequently Asked Questions How to Stream to Your TV Craftsy Membership Info Instructor Resource Center Become an Affiliate Corporate Subscriptions Spanish © 2022 Craftsy Terms of Service Privacy Policy Do Not Sell My Info Username or email * Password * Remember me Lost your password? Privacy Policy Enter in your email and password to create a FREE account Email address * Password * Anti-spam Your personal data will be used to support your experience throughout this website, to manage access to your account, and for other purposes described in our privacy policy. Chat Access over 1,500 Premium classes BECOME A MEMBER Purchase Options Premium Membership Sign up for the Premium Membership and get access to our best Craftsy videos and projects. Learn new craft techniques and tips from the experts. Anytime. Anywhere. Monthly Membership $899 Monthly Membership Annual Membership $8999 Save $15.89 with our annual Plan Annual Membership | negative |
Under the pretext of not disrupting bilateral relations between India and China, Ambassador Luo Zhaohui said the latter is ready to change the name of the China Pakistan Economic Corridor (CPEC) passing through Pakistan-occupied Kashmir (PoK). (Reuters)
Under the pretext of not disrupting bilateral relations between India and China, Ambassador Luo Zhaohui said the latter is ready to change the name of the China Pakistan Economic Corridor (CPEC) passing through Pakistan-occupied Kashmir (PoK). Addressing a session at the United Service Institution of India here on, Luo while denying China’s involvement in the sovereignty and territorial disputes between India and Pakistan, said the CPEC is for promoting economic cooperation and connectivity. “It (CPEC) has no connections to or impact on sovereignty issues. Even we can think about renaming the CPEC. China and India have had successful experience of delinking sovereignty disputes with bilateral relations before. China is sincere in its intention to cooperate with India on the One Belt One Road (OBOR) initiative, as it is good for both of us,” he said.
Citing China’s earlier measures to help tackle issues related to Kashmir, Luo said contrary to media reports of aiding Pakistan, China’s initiatives focus more on reaping its own benefits rather than supporting the stance of any other nation. “We always put China first and we deal with problems based on their own merits,” he said.
Emphasising on the importance of mediation between India, China and Pakistan, Luo said it is essential for collective development and stability of the entire region. On Sunday, Pakistan and China agreed to jointly oversee the CPEC and ensure transparency in the project as an agreement in this regard was signed between the National Accountability Bureau (NAB) and Beijing.
A combined initiative focusing on enhancing economic cooperation between China and Pakistan, the CPEC is being hailed to create 85,000 jobs for Pakistani youth. It is being facilitated to modernize infrastructure and transport networks in Pakistan through the creation of special economic zones and energy projects. The initial proposal was made in April 2015 during Chinese President Xi Jinping’s official state visit to Pakistan.
On April 20, 2015, Pakistan and China signed an agreement to commence work on the USD 46 billion agreement, with approximately USD 28 billion worth of fast-tracked projects to be developed by the end of 2018. | positive |
Getting a VMware vSphere Hypervisor license for Enterprise Manage – Enlighted Inc Help Center Submit a request Sign in Enlighted Inc Manage Guides Articles in this section Log4J Vulnerability Manage Overview Manage 4.4 Admin Guide Manage O&M Manual Daylight Groups Quick Guide Getting a VMware vSphere Hypervisor license for Enterprise Manage Getting a VMware vSphere Hypervisor license for Enterprise Manage July 12, 2022 18:41 Updated Print Follow The Enlighted Enterprise Manage (EEM), sourced from Dell, comes with VMware vSphere Hypervisor pre-loaded on the EEM server. The free license of the VMware Hypervisor starts with the full unlocked version. After the trial period of 60 days expires, it becomes limited in functionality though you can continue to use the system. When the trial period expires, Enlighted recommends that the customer registers and downloads the license and provides the license key to the Enlighted Support team, who can help to install the software on the customer's server. Note: Please submit a ticket to Enlighted Support with the license key. Refer to the VMWare License and Evaluation period explaining the license limitations. A description of different license types is available here: https://kb.vmware.com/s/article/2109507. To get the free license, The owner of the server needs to go to following VMWare URL and register. For ESXi 6- https://customerconnect.vmware.com/en/web/vmware/evalcenter?p=free-esxi6 For ESXi 7 - https://customerconnect.vmware.com/en/web/vmware/evalcenter?p=vsphere-eval-7 At the top of the webpage, go to "Products," "All Products." Select "Products" from the left panel. Select "vSphere Hypervisor (ESXi)" Click "Download Product." From the "License & Download" tab, click Register and fill out the form and submit. It's not necessary to actually download the software. The license key will appear after you register. Copy the license key that is on the "License & Download" tab. Paste the license key into the instance of VMware on your Enlighted Manage (you can refer to steps 7 and 8 on this website to see screenshots of this step: https://www.virten.net/2016/11/free-esxi-6-5-how-to-download-and-get-license-keys/) The Terms & Conditions are referenced at the bottom of the VMware web page. Was this article helpful? 2 out of 2 found this helpful Have more questions? Submit a request Related articles Gateway Bulletin Outdoor Enclosure Manage O&M Manual Log4J Vulnerability Control Unit (CU-4E-NME/NMI) Assign Facility to a User Comments 1 comment Sort by Date Votes Sharad Srivastava December 01, 2020 20:23 I followed the above steps and getting the license for ESXi7. But the EEM is build on ESXi6.7 (older EEM on ESXi6,5). How to get the license for ESXi6.7 & ESXi6.5? 0 Comment actions Permalink Please sign in to leave a comment. © 2022 Enlighted Inc. All Rights Reserved. Theme design by Lotus Themes All product names, trademarks, and registered trademarks are property of their respective owners. All company, product and service names used in this website are for identification purposes only. Use of these names, logos, and brands does not imply endorsement. Download Close | negative |
coal crushing equipment Home Products Solutions Project About Contact Top Equipments Popular searches crusher FRANCE, 1 ads of used crusher FRANCE Used crusher FRANCE, second hand crusher FRANCE for sale on Europe Construction Equipment - Buy rock crushing equipment crusher FRANCE europe-construction-equipment Europe-Construction-Equipment 100 construction equipment classified ads My account Place a classified ad .... Know More Coal Crushing Equipment Coal Crushing Equipment DRW Crusher Servic We have 25 years knowledge of , Brown Lenox, Powerscreen and other Crushing equipment Specialists in and Brown lenox crushers 4301 Hickoryview Dr, Louisville, Kentucky 40299, United States 502 777-3167 Specialists in and Brown lenox crushers... Know More Bottle Crushers PEL Waste Reduction Equipment offer single and multi-feed glass bottle crushers which generate significant cost, labour and space savings Click below and select the most appropriate bottle crusher for your needs or contact us on 094 936 6923 for advice... Know More Crusher Aggregate Equipment For Sale Nov 22, 2021 0183 32 Rolling Rock Equipment Mount Pleasant, Pennsylvania 15666 Phone 724 757-1049 View Details Contact Us Hazemag Crushing Plant with Two Conveyors Including - Simplicity Vibrating Feeder 45 x 14 Long - Hazemag APSE1013 40 Diameter x 52 Wide Primary Impactor - Side Discharge Conveyor 42 ,See More Details Get Shipping Quotes .... Know More Mobile Jaw Crusher Mills Cone J1175 Jaw Crusher Tracked Mobile Crusher Finlay The 174 finlay j-1175 is a high performance and aggressive tracked mobile jaw crusher incorporating a 174 jaques jw42 jaw crusher and a heavy duty vibrating grizzly feeder the 174 finlay j-1175 gives optimum production in a range of applications View more... Know More Portable Cutting and Crushing Tools The LSI 511V is a very rugged oversized cutter with reinforced aluminum cylinder body for high cutting frequency and mobile applications Double the cutting force of the other tools The tool is hand operated Simply twist valve or press push buttons to open or to close the blad... Know More xr400 jaw crusher 2006-12-1 Metal Scrap Crusher 650 HA Premiertrak jaw crusher Still standing in spite of tough competition from mobile equipment, stationary crushing plants still have a place in the industry On the move the desired end product is a driving factor when choosing a portable crusher 428 trackpactor impact crusher... Know More crusher component parts XA400S jaw crusherpares jaw , Jaw crusher can reach the crushing ratio of 4-6 and the shape of final product is even It is widely applied to crush high hardness, mid hardness and soft rocks and ores such as slag, construction materials, marble, etc The pressure resistance strength is under 200Mpa, that is, suitable for primary crush... Know More Coal Crusher Used 36s B Style Crusher Mills, Cone , Pe-250 400 Used 36s B Style Crusher Mills, Cone , Pe-250 400 Used 36s B Style Cms Cepcor Facebook , If you want know more about jaw crusher price, concrete jaw crusher, mobile jaw crusher, coal jaw ,... Know More rock crushing equipment Ganzhou Eastman provide Crushing Grinding equipment for sale, more specifically rock crushing and sand making processing equipmentClick here to ask for detaill In the past 30 years, we have focused on the research, development and manufacture of mining crushing equipment, sand making equipment, industrial milling equipment, and keep improving them ,... Know More jaw crusher specifications Mining Quarry Plant Jaw Crusher manufacturer, Using our large powered jaw crusher equipment and cone crusher plants, crusher can crush any type of material to any size requirement in , Specifications For Cedar kefids 1036 Jaw, process crusher ,... Know More Chinese Construction Equipment Portble Crusher Coal Crushing Equipment Praharicoin coal crushing equipment crushing screening overview finlay corporation finlay are world leaders in the design and manufacturing of quality crushing screening equipment leave your needs get a free quote used c morethere will Oem Crushing Equipment Components ... Know More coal crushing equipment Crusher Equipment heavy industry is specialized in the design, manufacture and supply of crushing equipment used in mining industry The product range of our company comprises mobile crushing plant, jaw crusher, cone crusher, impact crusher, milling equipment, ball mill, vibrating feeders, screens and equipment for washing sand... Know More manufacturer of portable cone crusher Coal Crushing Equipment Krosline Crusher limited is the worlds leading manufacturer of mobile crushing plant equipment and sells more tracked crushers in its size range than any other manufacturererex has a comprehensive range of crushing plants that are used in quarrying, mining, Chat Online Xh500 Crusher Price .... Know More 1180 PREMIERTRAK Construction Equipment , 1180 Premiertrak, Year 2007, C13 / 385hp engine / Tier 3, Approx 18,00000 hours with engine rebuilt back few years ago, Jaw opening 1100 x ,... Know More crusher At The Best Prices crusher at affordable prices only at Alibaba To improve the efficiency and quality of cementing, crusher are vital pieces of equipment, which is why you must not compromise on their quality It seals the casing to the wall completely, and the whole job would be unsuccessful if the casing touches the hole at any part... Know More Powerscreen Powerscreen, a world leading producer of mobile crushing, screening and washing equipment manufactures an extensive line of crusher machin Samscreen, Inc prides itself on manufacturing products that are customized and fully compatible with machines produced by the leading screener, crusher and trommel manufacturers in the world... Know More application soft starter for coal crusher kw hp rpm volts , Coal Crushing Equipment Krosline Coal Crushing Equipment has earned its world-class reputation for innovative research, excellence in manufacturing, and quality products due to its philosophy of putting customers needs firstur 1 goal is making the customer more productive and profitable by providing the best impactor-based ,... Know More AMC Crusher, Stone crushers, Mining and crushing equipment , AMC Crusher is committed to the development goal of first-class manufacturer of intelligent mining machinery with advanced production equipment, high-quality core products and sincere after-sales service commitment Read More gt gt... Know More 1000sr rate worldcrushers Aug 22, 2013 0183 32 Crusher Aggregate Equipment For Sale At MachineryTrader 2007 1000SR MAXTRAK, , Our crushers feature large ,... Know More china stone crusher coal crushing equipment Gulin provide the coal crushing equipment solution case for you , Stone Crushers Coal Application Case Minerial Solution Case More Ore Imformation SBM Series Single Toggle Jaw Crusher, 1180 Premiertrak... Know More Used crushers 1412 Manufacturer Model 1412 Track Ram to suit 1412 Tracked Impact Crusher Main Length - 22 Screw Length - 4 1/2 Diameter 7 Part Number - 2372-0084 Recoil / Tensioner... Know More Crusher Aggregate Equipment For Sale Dec 08, 2021 0183 32 Browse a wide selection of new and used Crusher Aggregate Equipment for sale near you at MachineryTrader Top models include 1000SR, 4242SR, 428 TRAKPACTOR, and 1000 MAXTRAK... Know More 4242Sr Crusher Specs 4242Sr Crusher Specs Learn more about 4242sr crusher specs equipment Powerscreen Mobile Crushing Screening Equipment Powerscreen one of the world leaders in the crushing and screening industry prepares to launch the most recent addition to their jaw crushing range the Powerscreen Premiertrak 330 The new Premiertrak 330 is fitted ,... Know More Jaw Crusher Coal Crushing Equipment Xr400 Jaw Crusher Worldcrushers May 18, 2013nbsp018332mining crushers mainly include jaw crusher, cone crusher, impact crusher, mobile crusher for crushing stone, rock, quarry materials in mining industry xr400 jaw crusher youtube xr400 xa400 mobile jaw crushers made by ... Know More coal crushing equipment Hartman Fabco Crushing Plant Used HARTMAN FABCO Used Portable Coal Crushing Plant consisting of following equipment Loader Feed Receiving Hopper, 428 TRACK IMPACTOR CRUSHER 2005 428 TRACK IMPACTOR CRUSHER 2005 428 TRACK IMPACTOR CRUSHER - USED SOLD Regular Price , All equipment is ,.... Know More manufacturer of portable cone crusher price Feb 10, 2021 Crushers For Sale - Equipment Trader Jan 14, 2021 In addition, considering that the hardness of the river pebble is extremely high and the crushing efficiency is relatively low, the graded crushing production line is best choice, that is, the PE500 750 jaw stone crusher is used first, and then the WLC1160 cone rock crusher is used for middle crushing, and then two ,... Know More Coal Crushing Equipment Cone Crusher Cork Screeners Crushers For Model Xa 400 Mobile Crushers All Over The model xa 400 heavy industry is specialized in the design manufacture and supply of crushing equipment used in mining industry the product range of our company comprises mobile crushing plant jaw crusher cone crusher impact ,... Know More Crusher Aggregate Equipment Auction Results , Browse a wide selection of new and used Crusher Aggregate Equipment auction results near you at MachineryTrader Top models include 1300 MAXTRAK, 1412 TRAKPACTOR, 4242SR, and 1165 PREMIERTRAK... Know More crusher Bourgogne, 2 ads of used crusher , Used crusher Bourgogne, second hand crusher Bourgogne for sale on Europe Construction Equipment - Buy rock crushing equipment crusher.... Know More Prev: hammer mill air plenum Next: ball mill produce MORE INFO Home Products Solutions Project About Contact CONTACT US You can contact our head-office directly, also you can contact the oversea-offices which is near you. Of course, free live-chat is available and you can get help immediately. LIVE-CHAT News traylor crushers 2022-04-06 equipments used to break the rock 2022-04-05 video mixer price in nigeria 2022-04-04 import jaw crusher bandung 2022-04-03 jowar mill machine price in malaysia 2022-04-02 cyclone crusher price in used 2022-04-01 hammermills farming equipment outdoors diy south africa 2022-03-31 hard rock gold mining equipment rock crushers 2022-03-30 used car crusher on craigslist 2022-03-29 Copyright © 2021-2022.SKY All rights reserved. Sitemap | negative |
If you're a U.S. college student, or at least having a working .edu email address, you don't have to pay $120 to upgrade Vista to Windows 7. You can get the Home Premium upgrade for just $30. Updates: See below.
Our blog sibling Gizmodo just noticed a Microsoft promotion at Win741.com, offering U.S. students Windows 7 Home Premium for just $30. That's a good deal better than the $120 retail price for an upgrade, and, as with the Ultimate Steal Office offering, Microsoft and cohorts aren't exactly going to ring up your alma mater's provost to ensure you're still enrolled there when you hand over your .edu mail address.
Advertisement
Hit the "Buy" link in the middle-left box on the viral-marke-tastic 741 site to sign for the $30 offering, a deal that's valid until Jan. 3.
Update: The information below was the original text of this post involving a $19 Windows 7 Professional offering. We emailed the Association for Computing Machinery and heard back from Lillian Israel, director of membership, who noted that Windows 7 purchases have been pulled from the ACM's discounted license offerings due to misuse of memberships.
Advertisement
The CyberNet blog points any student with an interest or inclination toward the "science, technology, engineering, and mathematics fields" to check out the Association for Computing Machinery (ACM), where a membership is $19 and one of membership's key perks is access to Microsoft's MSDN Academic Alliance catalog. That lets you snag Office and other normally high-priced products for very low prices, and Windows 7 Professional licenses for free, minus the cost of membership. A single validation key for Windows 7 Professional at the cost of a pizza is pretty good, but CyberNet sweetens the deal by noting that picking up eight separate keys for 32- and 64-bit version of Windows 7 in four different languages gives you eight keys that work on any installation.
741 [via Gizmodo] | positive |
NEW YORK – St. Louis Blues right wing T.J. Oshie, Washington Capitals right wing Alex Ovechkin and Montreal Canadiens goaltender Carey Price have been named the NHL's "Three Stars" for the week ending Jan. 4.
FIRST STAR – T.J. OSHIE, RW, ST. LOUIS BLUES
Oshie paced all players with five goals and shared the League lead with seven points to power the Blues (23-13-3, 49 points) to two wins in four starts. He collected one assist in a 3-0 triumph over the Colorado Avalanche Dec. 29. Oshie then found the back of the net in a pair of losses – a 3-2 defeat to the Nashville Predators Dec. 30 and a 4-3 decision to the Anaheim Ducks Jan. 2. He capped the week by registering his second career hat trick (also March 27, 2014 vs. MIN) and second career four-point performance (also Nov. 14, 2013 vs. COL: 0-4—4), notching 3-1—4 in a 7-2 victory over the San Jose Sharks Jan. 3. He also potted his 19th career game-winning marker (third this season) and eclipsed 100 NHL goals (101-174—275 in 402 GP) in that contest. The 28-year-old Everett, Wash., native has compiled 10-10—20 in 31 outings this season, including 5-3—8 during a five-game point streak.
SECOND STAR – ALEX OVECHKIN, RW, WASHINGTON CAPITALS
Ovechkin recorded 1-1—2 in all three of his games, totaling 3-3—6 to lead the Capitals (20-11-7, 47 points) to five out of a possible six standings points. He helped the team erase a three-goal, third-period deficit in an eventual 4-3 overtime loss to the New York Islanders Dec. 29, scoring the tying goal with 2:41 left in the third period. Ovechkin then powered the Capitals to a 3 2 victory over the Chicago Blackhawks in the 2015 Bridgestone NHL Winter Classic Jan. 1, picking up the primary assist on Troy Brouwer's game-winning marker with 12.9 seconds remaining in regulation. The Capitals captain closed the week with his third straight multi-point performance – the first time he has achieved that feat since March 21-24, 2013 – in a 4-3 triumph over the Florida Panthers Jan. 4. The 29-year-old Moscow, Russia, native shares sixth in the NHL with 19 goals this season (19-15—34 in 38 GP), including 7-6—13 in his past 12 outings.
THIRD STAR – CAREY PRICE, G, MONTREAL CANADIENS
Price went 3-0-0 with a 1.33 goals-against average and .952 save percentage to backstop the Canadiens (26-11-2, 54 points) to four straight victories and first place in the Eastern Conference. He opened the week by making 28 saves in a 3-1 triumph over the Carolina Hurricanes Dec. 29. Price then stopped 22 shots in a 4-2 victory over the New Jersey Devils Jan. 2, earning his 200th career win in his 400th NHL appearance. He capped the week by recording 30 saves in a 4-1 triumph over the Pittsburgh Penguins Jan. 3. The 27-year-old Anahim Lake, B.C., native shares second in the NHL with 22 wins this season, compiling a 2.14 goals-against average, .929 save percentage and two shutouts in 32 appearances. He also has won five straight games, his second such run of the season (also Oct. 16-28), totaling a 1.20 goals-against average and .959 save percentage during the current stretch. | positive |
Since reviewing the Turner prize exhibition as it opened, it is Assemble’s project that has stayed with me – though at the time I enjoyed Bonnie Camplin’s project, with its evocation of paranoia and conspiracy theories, very much. Nicole Wermer’s arrangement of Marcel Breuer’s Bauhaus Cesca chairs, each of which had a luxuriant fur coat draped across its back, felt like a particularly chilly academic exercise. Watching Janice Kerbel’s Doug – with its black-clad singers and its limp, sometimes winsome doggerels – I kept thinking of the toe-curling acapella concert amusements the King’s Singers provide. It was dreadfully overwritten.
Urban regenerators Assemble win Turner prize Read more
Assemble’s win signifies a larger move away from the gallery into public space that is becoming ever more privatised. It shows a revulsion for the excesses of the art market, and a turn away from the creation of objects for that market. Their structure that was on show at this year’s Turner exhibition must be seen not as a work, but as a model of work that takes place elsewhere; not in the art world, but the world itself.
For the exhibition, Assemble recreated a full-size, wooden mockup of one of the houses in Granby in south Liverpool they have been refurbishing with locals. They filled it with the ceramics, fireplace surrounds, stools, doorhandles and furnishings they and the residents have been making both to use in the houses and to sell in order to generate income. The overall aesthetic was stripped-down and clean, without being conspicuously forced or arty.
Facebook Twitter Pinterest Stripped-down and clean, without being too forced or arty ... Assemble’s Turner exhibition. Photograph: Murdo MacLeod for the Guardian
When this year’s shortlist was announced, I wrote that Assemble raised questions about whether their work is in fact art, or instead a kind of socially-engaged design practice. In some ways, their activities mirror Theaster Gates’s efforts to regenerate a corner of South Chicago, just as his recent project in Bristol was a joyous social intervention. Unlike Gates, Assemble do not make artworks to supplement their larger projects – though the fireplaces, benches and ceramics do make some money for Granby. Assemble are also indebted to the utopian 19th-century projects of William Morris; they extend their artfulness into everyday life.
The street that might win the Turner prize: how Assemble are transforming Toxteth Read more
Winning the Turner prize does not necessarily depend on one artist delivering a knock-out exhibition. Juries consider each artist’s work as a whole (though the show itself can make or break their chance of winning). Assemble don’t really do gallery shows. Their art ignores the art market. Useful and inspiring, Assemble demonstrate how artists and architects can engage with communities, and work creatively in the wider social sphere.
During the 1970s and 80s many artists, living in short-term properties (most famously through the London artist’s housing and studio co-op ACME), temporarily regenerated patches of east London destined for the bulldozers. With studios and housing unaffordable in London now, such ventures are vital. But Assemble isn’t just about artists doing it for themselves. Their work can be seen as part of a battle against social division, and against the precariousness of life under neo-liberal capitalism. How right-on, you might say.
The danger of projects like theirs is that it will be seen to replace government intervention, leading to further withdrawals of public funds and further atomisation. (They might easily have been instrumentalised by David Cameron’s bullshit talk on The Big Society had he had the chance.) But not every community has an Assemble round the corner on hand to help.
I am unsurprised that Assemble have won, given that one of the current Turner judges, Alistair Hudson, director of Middlesbrough Institute of Modern Art (mima), views his museum as a service to the community, a facility rather than a place where big-shot artists have major shows. How good is Assemble’s work? It is full of invention and ingenuity. It has purpose. What they are not doing is following a familiar artistic career pattern. It is art if they say so, and I don’t care if it is art or not. Winning the Turner prize is a vindication of their work. | positive |
Become a Native Advertising Expert Copyright © 2021 Outbrain Inc. All rights reserved. Outbrain is a trademark of Outbrain Inc. Interest-Based Ads (and Opt-Out Preferences) Advertising Guidelines Privacy Policy Security Patents Terms of Use Become a Native Advertising Expert After countless successful Outbrain Academies across the globe, we decided to put together all of our knowledge and expertise in a world-class, on-demand program. Become a certified Native Advertising Expert at your own pace and convenience. See what fellow marketers have said about the Outbrain Academy program: Ready to Get Started? Type of Company*BrandAgencyAffiliatePublisherProgrammatic Platform Yes! I'm happy to get Outbrain emails on product updates, insights, and more. I can unsubscribe at any time. Yes, I would like a Native Ads expert to contact me by email. Enroll Now! Ready to fast track your marketing skills? It's exciting to see how the training supports a holistic planning approach and unselfishly educates on Native as a channel. I would recommend this training to all marketing folks at all levels. Brilliant module on advanced strategies for native advertising. An essential primer to refer to for creating impactful and activation-driven digital marketing campaigns. Become a Native Advertising Expert Ready to fast track your marketing skills? Join our Outbrain Academy to become a certified Native Advertising Expert. It's exciting to see how the training supports a holistic planning approach and unselfishly educates on Native as a channel. I would recommend this training to all marketing folks at all levels. An essential primer to refer to for creating impactful and activation-driven digital marketing campaigns Brilliant module on advanced strategies for native advertising. Ready to Get Started? Enroll Now! See what other fellow marketers have said about the Outbrain Academy program: Enroll Now! Join our Outbrain Academy to become a certified Native Advertising Expert. In the Outbrain Academy, you'll discover a range of free learning courses designed to help you achieve your business goals and develop your digital marketing skills. You'll learn about Native Advertising on the open web, the benefits of diversifying your media mix, and the best practices to craft your creatives and boost campaign performance. Enroll Now! After countless successful Outbrain Academies across the globe, we decided to put together all of our knowledge and expertise in a world-class, on-demand program. Become a certified Native Advertising Expert at your own pace and convenience. In the Outbrain Academy, you'll discover a range of free learning courses designed to help you achieve your business goals and develop your digital marketing skills. You'll learn about Native Advertising on the open web, the benefits of diversifying your media mix, and the best practices to craft your creatives and boost campaign performance. Native Advertising Strategy Expert Course Details Specifically tailored to media planners and buyers, you will learn which trends in digital marketing led to the rise of Native Advertising and why it is so important to diversify your media planning beyond the walled gardens of Search and Social. Learn how the evolution of Native Advertising led to new formats suitable for campaign goals and KPIs at any stage of the funnel, and which solutions to choose to achieve the best results. You will gain knowledge on best practices for creatives, and how to effectively target and buy Native Advertising. Native Advertising Strategy Expert Specifically tailored to media planners and buyers, you’ll learn which trends in digital marketing led to the rise of Native Advertising and why it is so important to diversify your media planning beyond the walled gardens. Join your trainer for an overview on how Native Advertising has evolved with an update on the latest formats to achieve your campaign KPIs. You’ll get tips and best practices on creatives, targeting and buying native advertising, as well as an intro to Native Programmatic. Enroll Now!Enroll Now! Your data will be processed according to our Privacy Policy THE POWER OF NATIVE ADVERTISING Who should take the course? This course is suitable for both beginners and advanced digital media planners and buyers as well as marketing professionals interested in integrating Native Advertising in their marketing plan. We'll give you the concepts, tools, and best practices you need to get the best results. Introduction Module 1 – The Native Advertising Revolution Module 2 – Smartly Diversify your Media Mix Module 3 – The Best Solution by KPI Module 4 – Creatives for Success Module 5 – Advanced Native Advertising Strategies Module 6 – Outbrain 101 SHOW MORE + Courses Available UNLOCKING PERFORMANCE WITH NATIVE Who should take the course? This course fits media planners, buyers, and marketing professionals familiar with digital platforms who are seeking new ways to boost campaign performance. We’ll talk about the different KPIs, latest formats, and innovative tools that enable Native Advertising to be a strong driver of your business growth. Introduction Module 1 – Beyond Cookies Module 2 – Expanding Your Performance with Native Module 3 – Performance Solutions for your business Module 4 – Best Recommendations for Performance Campaigns SHOW MORE + Enroll Now! ENGLISHFRENCHITALIANPORTUGUESESPANISHJAPANESE | negative |
We are living in society’s twilight years – if a professor of ecology and mathematics from the University of Connecticut is correct. Studying history as a science with variables and trends, he predicts the 2020s will see massive instability.
For some, our political future is frightening. Others find it exciting. But Professor Peter Turchin from the University of Connecticut claims that it is time to prepare for political turmoil that could rock society to its core.
Turchin is known for developing a cross-disciplinary subject known as “cliodynamics,” which treats history like any other science, with predictions and models. He has been writing about the subject for some time, but three years ago he began working on predicting the future. One of his predictions was: “We should expect many years of political turmoil, peaking in the 2020s.”
Read more
Turchin says that “the negative trends seem to be accelerating,” and that in three years, the path to instability will seem unavoidable. He was quick to point out that Donald Trump’s presidential election neither accelerates nor decelerates the process, but was simply a predicted aspect of his theory.
Turchin’s concepts include “elite overproduction,” in which the rich grow richer and relate less and less to the poor. He said that elite overproduction would result in “ideological polarization and fragmentation of the political class.” He used the 2016 election as a prime example, and explained that the Republican party has shattered into different factions consisting of Traditional Republicans, Tea Party Republicans, and Trump Populists.
He also said the same applies to the Democratic Party, with the divide between Democratic Socialists and Establishment Democrats.
Turchin also notes that the weakening fiscal health of the state, which occurs as revenues fall and expenses rise, while quality of life stagnates and declines, will also play into instability in the US.
Trump’s proposed policies appear to fall in line with his predicted course towards total meltdown.
“Drastically reducing taxes on wealthy Americans will hardly strengthen the fiscal health of the state,” he wrote.
So does this mean that we should start preparing bomb shelters? Not necessarily, according to Turchin. While current events may be following his predicted trends, he does not believe that they are the be-all and end-all. “This is a science-based forecast, not a ‘prophecy’” he explained.
In order to avoid a major meltdown, Turchin proposes “an open discussion of problems and potential solutions,” but as anyone who has been on Twitter lately knows, that may prove difficult.
He also cited the need for better science, saying that a nonpolitical, nonpartisan institute should be set up to address these issues from a scientific standpoint. | positive |
Weight Management Products - IHRSA Buyers' Guide - IHRSA Buyers' Guide Sign Up Sign in Help Search Featured Products E-Books Webinars Press Releases My List Get Listed IHRSA.org Home Featured Products (2) IGNITE ABC Fitness Solutions ABC IGNITE redefines how fitness operators and members interact with technology to reach their respective goals. The flexible, scalable and intuitive club management solution has all of the tools gym owners and operators need to accelerate business performance, operate efficiently and deliver 360° member experiences. Reduce the cost of managing disparate systems, empower your teams, and tackle all of the ‘jobs to be done’ in your club with a modern new solution from ABC, a consistent and dedicated partner to gyms and health clubs for over 40 years. Sponsored by: Performance Plus Treadmill Matrix Fitness The Performance Plus Treadmill sets a new standard with a shock-absorbing slat-belt and a high-efficiency drive that make even the most intense runs feel comfortable, solid and smooth, lasting up to 100,000 miles in the most intense environments. Despite this incredible evolution of technology, service and maintenance have never been easier. Sponsored by: No Products meet the selected criteria. Categories: Weight Management State: Oklahoma, Gyor Country: Canada Please refine your search filters. Click here to start over. Narrow Your Search Categories: Weight Management State: Oklahoma, Gyor Country: Canada 'Clear all filters... Categories: Weight Management' Aquatic Fitness Equipment, Parts & Equipment, Pool Products & Services, All Associations, IHRSA 2022 Exhibitor, Accounting, Franchising / Licensing, Insurance, Leasing / Financing, Legal Services, Logistics, Marketing / Promotions, Payroll, Retention Resources, Architects, Construction, Décor, Facility Designers, Child Care, Cleaning Products, Office Supplies, Uniforms, Food / Beverage, Sport / Energy Drinks, Supplements, Management, Personnel, Promotion, Sales / Marketing, Training, Air Filtration, Gloves & PPE, Hand Hygiene, Manufacturer Equipment Cleaning Recommendations, Reopening Resources, Signage, Surface Cleaning & Disinfecting, Technology Products & Software, Temperature Scanners, Virtual Offerings, Certifying Organizations, Educational Organizations, Publications / Magazines / Publishing, Furniture, HVAC, Laundry, Lighting, Security / Locks, Accessories, Bikes, Circuit Training, Climbers, Core Training, Elliptical / Cross Trainers, Free Weight Equipment, Functional Training, High Intensity Interval Training (H.I.I.T), Inclusive Fitness, Multistations, Parts / Service / Repair, Plate Loaded, Reconditioned / Refurbished, Rowers, Selectorized, Ski Machines, Strength Training Equipment, Stretching, Suspension Training, Treadmills, Aerobic, Court Surfaces, Weight Room, Equipment, Group Training, Indoor Cycling, Programming, Virtual, Nutrition, Physical Therapy / Rehabilitation Equipment, Senior Programming, Special Populations, Stress Management, Weight Management, Youth, Body Composition Testing, Fitness Testing, Heart Rate Monitors, Instructional Charts, Scales, Stress Testing, Benches, Laundry Equipment, Locker Room Products, Lockers, Towels, Equipment, Programming, Apparel, Footwear, Sporting Goods, Automated External Defibrillators (AED's), CPR Certification Programs, First Aid Kits, Pool Safety, Slip Resistant Mats, Massage Equipment, Saunas, Spa Products, Spa Services, Steam / Sauna Services, Steam Showers / Baths, Tanning, Asset Management, Audio / Visual, Customer Relationship Management (CRM), EFT / Payment Processing, Exercise Entertainment / Gaming, Financial, Fitness Testing, Front Desk / Secure Check-in, Mobile Solutions / Apps, Sales / Management Systems, Wearable Fitness Tracking, Web Services, [None] State: Oklahoma' Gyor' British Columbia, Ontario, [None] Country: Canada' Australia, Austria, Canada, China, Hungary, Ireland, Israel, Italy, Luxembourg, Netherlands, Norway, Poland, South Korea, Taiwan, Turkey, United Arab Emirates, United Kingdom, United States, Association Buyers Guide Non-dues Revenue Webinars Whitepapers Product Showcase Powered by Webvent :: Professional Content Networks :: Terms :: Privacy © 2022 Webvent, Inc. | negative |
Express News Service By
Wives of public servants have a right to access salary particulars of their husbands and denial of such information is highly unreasonable, unjustified and amounting to breach of legal obligation, the Central Information Commission (CIC) has held.
Information Commissioner M Sridhar Acharyulu, while disposing of an application filed by one Jyoti Seherawat, said it was the duty of public authority to render required assistance to a public servant’s wife when she seeks her husband’s salary particulars.
He said the information related to the salary was necessary to secure justice.
The information was denied to Seherawat by Home (General) Department, claiming that the third party has objected to its disclosure.
Sridhar said in most cases information about a husband’s salary was denied with mala fide intention either to harass the spouse, delay justice or to avoid payment of maintenance.
He also warned that denial of salary information could incur a penalty under Section 20 of the RTI Act, 2005.
Citing various personal laws, Sridhar said a husband has a legal duty to maintain the wife and children and this was applicable even after divorce.
“Section 125 of the Criminal Procedure Code mandate that a husband has a general duty to maintain wife and children. The wife’s entitlement to know the salary particulars of her husband gets further fortified by all the above legal provisions.”
In his January 7, 2014 order, Sridhar said the salary paid to a public servant by the public authority was sourced from the tax paid by public and they have a right to access it as per the RTI Act.
He also maintained that such disclosure should be done voluntarily and added that salary of a public servant could not be considered as third party information. | positive |
Sharon Leal Crest Research Centre for Research and Evidence on Security Threats AboutProjectsOpportunitiesCREST Security Review Search Site search Full Menu Search text Submit search query Close search panel A B C D E F G H I J K L M N O P Q R S T U V W X Y Z Breadcrumbs Home Authors Sharon Leal Senior Research Fellow, University of Portsmouth Sharon obtained a first class honours degree in Psychology at the University of Portsmouth in 2000 before completing a PGDip in research methods. Her PhD was funded by the ESRC and focused on the physiology of attention and cognitive demand. Since finishing her PhD, she has worked with Professor Vrij on grants from the ESRC and UK / US governments. Her current research involves interviewing to detect deception, where the main focus is to elicit information and maximise differences between liars and truth tellers’ accounts. This research is very relevant for detecting how people engaged in ‘high stake’ deception respond verbally and non-verbally in a variety of scenarios. Her work involves cooperation with national and international governments and police. She is a member of the European consortium of Psychological Research on Deception Detection (E-prodd). The consortium utilises cutting edge research from laboratories across Europe to optimise the detection of deception in serious crime. Personal webpage Recent publications Ewens, S., Vrij, A., Leal, S., Mann, S., Jo, E., & Fisher, R. P. (in press). The effect of interpreters on eliciting information, cues to deceit and rapport. Legal and Criminological Psychology. Leal, S., Vrij, A., Warmelink, L., Vernham, Z., & Fisher, R. (2015). You cannot hide your telephone lies: Providing a model statement as an aid to detect deception in insurance telephone calls. Legal and Criminological Psychology, 20, 129-146. Nahari, G., Leal, S., Vrij, A., & Warmelink, L. (2014). Did somebody see it? Applying the verifiability approach to insurance claims. Investigative Psychology and Offender Profiling, 11(3), 237-243. Vernham, Z., Vrij, A., Mann, S., Leal, S., & Hillman, J. (2014). Collective interviewing: Eliciting cues to deceit using a turn-taking approach. Psychology, Public Policy and Law, 20, 309-324. Vrij, A., Leal, S., Mann, S., Vernham, Z., & Brankaert, F. (in press). Translating theory into practice: Evaluating a cognitive lie detection training workshop. Journal of Applied Research in Memory and Cognition. doi:10.1016/j.jarmac.2015.02.002 ---> Home BASS22 About Projects Magazine Opportunities Categories Authors © Centre for Research and Evidence on Security Threats | Privacy & Cookies Built by millipedia MENU Close menu Home BASS22 About Open submenu Get Involved News & Social Contact Governance Copyright Privacy & Cookies Projects Magazine Opportunities Categories Open submenu Behavioural Analytics Beliefs & Ideology CVE Cyber risk Decision-making Disinformation Extremist actors Interviewing Protective security Radicalisation Risk assessment Stress & Resilience Authors Copyright information Back to top | negative |
Zoonotic Pathogens in Wildlife Traded in Markets for Human Consumption, Laos — MORU Tropical Health Network Cookies on this website We use cookies to ensure that we give you the best experience on our website. If you click 'Accept all cookies' we'll assume that you are happy to receive all cookies and you won't see this message again. If you click 'Reject all non-essential cookies' only necessary cookies providing core functionality such as security, network management, and accessibility will be enabled. Click 'Find out more' for information on how to change your cookie settings. Accept all cookies Reject all non-essential cookies Find out more Site Map Accessibility Cookies Contact us Log in About Aims & Objectives Structure Study Sites Significant achievements Equity, Diversity and Inclusion Supporters How to find us Contact Us News News Research Highlights Units & Depts MORU Bangkok SMRU (Thailand) LOMWRU (Lao PDR) COMRU (Cambodia) MOCRU (Myanmar) Research Areas Malaria Mother and child health Microbiology & non-malaria infections Critical illness Medicine quality Statistics, data & modelling Bioethics & Engagement Our team Publications Researcher Podcasts Work & Study COPCOV COVID-19 MOTIP Search Publications Zoonotic Pathogens in Wildlife Traded in Markets for Human Consumption, Laos Zoonotic Pathogens in Wildlife Traded in Markets for Human Consumption, Laos Nawtaisong P., Robinson MT., Khammavong K., Milavong P., Rachlin A., Dittrich S., Dubot-Pérès A., Vongsouvath M., Horwood PF., Dussart P., Theppangna W., Douangngeum B., Fine AE., Pruvot M., Newton PN. Original publication DOI 10.3201/eid2804.210249 Type Journal article Journal Emerging Infectious Diseases Publisher Centers for Disease Control and Prevention (CDC) Publication Date 04/2022 Volume 28 Pages 860 - 864 © 2022 Mahidol Oxford Tropical Medicine Research Unit (MORU), Faculty of Tropical Medicine, Mahidol University, 3/F, 60th Anniversary Chalermprakiat Building, 420/6 Rajvithi Road, Bangkok 10400 Thailand Freedom of Information Privacy Policy Copyright Statement Accessibility Statement Site Map Accessibility Cookies Contact us Log in About Aims & Objectives Structure Study Sites Significant achievements Equity, Diversity and Inclusion Supporters How to find us Contact Us News Research Highlights Ethical considerations in deploying triple artemisinin-based combination therapies for malaria: An analysis of stakeholders’ perspectives in Burkina Faso and Nigeria Outdoor residual spraying for malaria vector-control in Kayin (Karen) state, Myanmar: A cluster randomized controlled trial The quality of veterinary medicines and their implications for One Health A family cluster of cutaneous Leishmania major infection unresponsive to intralesional meglumine antimonial: Case reports Perioperative Care Pathways in Low- and Lower-Middle-Income Countries: Systematic Review and Narrative Synthesis Improving the diagnosis of severe malaria in African children using platelet counts and plasma PfHRP2 concentrations Decentralised hepatitis C testing and treatment in rural Cambodia: evaluation of a simplified service model integrated in an existing public health system “Like a wake-up call for humankind”: Views, challenges, and coping strategies related to public health measures during the first COVID-19 lockdown in Thailand Impact of delayed processing of positive blood cultures on organism detection: a prospective multi-centre study High burden of childhood tuberculosis in migrants: a retrospective cohort study from the Thailand–Myanmar border Contribution of genetic factors to high rates of neonatal hyperbilirubinaemia on the Thailand-Myanmar border Childhood encephalitis in the Greater Mekong region (the SouthEast Asia Encephalitis Project): a multicentre prospective study Under the Mask: A Film on Tuberculosis at the Thai-Myanmar Border Should peer reviewers be paid to review academic papers? Facilitating safe discharge through predicting disease progression in moderate COVID-19: a prospective cohort study to develop and validate a clinical prediction model in resource-limited settings Triple therapy with artemether–lumefantrine plus amodiaquine versus artemether–lumefantrine alone for artemisinin-resistant, uncomplicated falciparum malaria: an open-label, randomised, multicentre trial History and evolution of tuberculosis and global health The proxy dilemma: Informed consent in paediatric clinical research - a case study of Thailand Anopheles salivary antigens as serological biomarkers of vector exposure and malaria transmission: A systematic review with multilevel modelling Community engagement for malaria elimination in the Greater Mekong Sub‑region: a qualitative study among malaria researchers and policymakers Utility of InTray COLOREX Screen agar and InTray COLOREX ESBL agar for urine culture in the Lao PDR The impact of COVID-19 non-pharmaceutical interventions on the lived experiences of people living in Thailand, Malaysia, Italy and the United Kingdom: A cross-country qualitative study Transforming Nepal’s primary health care delivery system in global health era: addressing historical and current implementation challenges Mapping genetic markers of artemisinin resistance in Plasmodium falciparum malaria in Asia: a systematic review and spatiotemporal analysis A case–control study of the causes of acute respiratory infection among hospitalized patients in Northeastern Laos Clinical impact of vivax malaria: A collection review Geoeconomic variations in epidemiology, ventilation management, and outcomes in invasively ventilated intensive care unit patients without acute respiratory distress syndrome Global antibiotic consumption and usage in humans, 2000–18: a spatial modelling study Antimicrobial resistance detection in Southeast Asian hospitals is critically important from both patient and societal perspectives, but what is its cost? Co-evolutionary signals identify Burkholderia pseudomallei survival strategies in a hostile environment Orientia tsutsugamushi dynamics in vectors and hosts: ecology and risk factors for foci of scrub typhus transmission in northern Thailand A descriptive study of Forcefully Displaced Myanmar Nationals (FDMN) presenting for care at public health sector hospitals in Bangladesh The cardiovascular effects of amodiaquine and structurally related antimalarials: An individual patient data meta-analysis Saving babies’ lives (SBL) – a programme to reduce neonatal mortality in rural Cambodia: study protocol for a stepped-wedge cluster-randomised trial Development of weight and age-based dosing of daily primaquine for radical cure of vivax malaria Clustering of malaria in households in the Greater Mekong Subregion: operational implications for reactive case detection Dynamics of G6PD activity in patients receiving weekly primaquine for therapy of Plasmodium vivax malaria A spatio-temporal analysis of scrub typhus and murine typhus in Laos; implications from changing landscapes and climate Suicidal ideation in the perinatal period: findings from the Thailand–Myanmar border Preprints in times of COVID19: the time is ripe for agreeing on terminology and good practices Grandparent caregiving in Cambodian skip-generation households: Roles and impact on child nutrition Identifying prognostic factors of severe metabolic acidosis and uraemia in African children with severe falciparum malaria Mass drug administration for the acceleration of malaria elimination in a region of Myanmar with artemisinin-resistant falciparum malaria Surveillance strategies using routine microbiology for antimicrobial resistance in low- and middle-income countries Case Report: Children with Severe Nutritional Rickets in the Naga Region in Northwest Myanmar, on the border with India A randomized controlled trial of dihydroartemisinin-piperaquine, artesunate-mefloquine and extended artemether-lumefantrine treatments for malaria in pregnancy on the Thailand-Myanmar border Arterolane–piperaquine–mefloquine versus arterolane–piperaquine and artemether–lumefantrine in the treatment of uncomplicated Plasmodium falciparum malaria in Kenyan children Global economic costs due to vivax malaria and the potential impact of its radical cure: A modelling study Geographical distribution of Burkholderia pseudomallei in soil in Myanmar Why do people purchase antibiotics over-the-counter? A qualitative study with patients, clinicians and dispensers in central, eastern and western Nepal Falciparum but not vivax malaria increases the risk of hypertensive disorders of pregnancy in women followed prospectively from the first trimester Ambulatory induction phase treatment of cryptococcal meningitis in HIV integrated primary care clinics, Yangon, Myanmar Laboratory informatics capacity for effective antimicrobial resistance surveillance in resource-limited settings Assessing the impacts of short-course multidrug-resistant tuberculosis treatment in the Southeast Asia Region using a mathematical modeling approach Perinatal depression in migrant and refugee women on the Thai–Myanmar border: does social support matter? Prediction of disease severity in young children presenting with acute febrile illness in resource-limited settings: a protocol for a prospective observational study Rolling out the radical cure for vivax malaria in Asia: a qualitative study among policy makers and stakeholders Burden of soil-transmitted helminth infection in pregnant refugees and migrants on the Thailand-Myanmar border Deploying triple artemisinin-based combination therapy (TACT) for malaria treatment in Africa: ethical and practical considerations Predictors of disease severity in children presenting from the community with febrile illnesses: a systematic review of prognostic studies G6PD Variants and Haemolytic Sensitivity to Primaquine and Other Drugs Improving treatment and outcomes for melioidosis in children, northern Cambodia, 2009–2018 What is the yield of malaria reactive case detection in the Greater Mekong Sub-region? Outcomes for 298 breastfed neonates whose mothers received ketamine and diazepam for postpartum tubal ligation in a resource-limited setting Vaginal Microbiota and Cytokine Levels Predict Preterm Delivery in Asian Women Short maternal stature and gestational weight gain among refugee and migrant women birthing appropriate for gestational age term newborns Protective effect of Mediterranean-type glucose-6-phosphate dehydrogenase deficiency against Plasmodium vivax malaria Tenofovir disoproxil fumarate in pregnancy for prevention of mother to child transmission of hepatitis B in a rural setting on the Thailand-Myanmar border Effectiveness of a sepsis programme in a resource-limited setting Human, animal, water source interactions and leptospirosis in Thailand Serological evidence indicates widespread distribution of rickettsioses in Myanmar Old age is associated with decreased wealth in rural villages in Mtwara, Tanzania Prevalence of MDR organism (MDRO) carriage in children and their household members in Siem Reap Province, Cambodia Crowding has consequences: Prevention and management of COVID-19 in informal urban settlements Impact of low blood culture usage on rates of antimicrobial resistance MALDI-TOF mass spectrometry for sub-typing of Streptococcus pneumoniae Research ethics in context: understanding the vulnerabilities, agency and resourcefulness of research participants living along the Thai–Myanmar border TB outcomes and mortality risk factors in adult migrants at the Thailand-Myanmar border Malaria Screener: a smartphone application for automated malaria screening Antimicrobial use in food animals and human health: time to implement ‘One Health’ approach Transmission of artemisinin-resistant malaria parasites to mosquitoes under antimalarial drug pressure Impact of outdoor residual spraying on the biting rate of malaria vectors in Myanmar How many human pathogens are there in Laos? An estimate of national human pathogen diversity and analysis of historical trends The efficacy of PPE for COVID-19-type respiratory illnesses in primary and community care staff Implementing parasite genotyping into national surveillance frameworks Tenofovir for prevention of mother to child transmission of hepatitis B in migrant women in a resource-limited setting on the Thailand-Myanmar border: a commentary on challenges of implementation Case-control study of use of personal protective measures and risk for severe acute respiratory syndrome coronavirus 2 infection, Thailand Estimating the proportion of Plasmodium vivax recurrences caused by relapse Febrile Illness Evaluation in a Broad Range of Endemicities (FIEBRE): protocol for a multisite prospective observational study of the causes of fever in Africa and Asia G6PD deficiency in malaria endemic areas of Nepal No evidence that chloroquine or hydroxychloroquine induce hemolysis in G6PD deficiency Integration of HIV services with primary care in Yangon, Myanmar Burkholderia pseudomallei multi-centre study to establish EUCAST MIC and zone diameter distributions and epidemiological cut-off (ECOFF) values Molecular epidemiology of resistance to antimalarial drugs in the Greater Mekong subregion Evaluation of the forum theatre approach for public engagement around antibiotic use in Myanmar Screening of ectoparasites from domesticated dogs for bacterial pathogens in Vientiane, Lao PDR Respiratory support in COVID-19 patients, with a focus on resource-limited settings Non-adherence in non-inferiority trials: pitfalls and recommendations Quantifying antibiotic impact on within-patient dynamics of extended-spectrum beta-lactamase resistance Pregnancy outcomes and risk of placental malaria after artemisinin-based and quinine-based treatment for uncomplicated falciparum malaria in pregnancy Quantification of glucose-6-phosphate dehydrogenase activity by spectrophotometry Causes of fever in primary care in Southeast Asia and the performance of C-reactive protein in discriminating bacterial from viral pathogens Barriers and facilitators to healthcare workers’ adherence with infection prevention and control guidelines for respiratory infectious diseases Efficacy and tolerability of artemisinin-based and quinine-based treatments for uncomplicated falciparum malaria in pregnancy Plasmodium falciparum ATP4 inhibitors to treat malaria: worthy successors to artemisinin? The estimated burden of scrub typhus in Thailand from national surveillance data (2003-2018) Longevity of the insecticidal effect of three pyrethroid formulations applied to outdoor vegetation on a laboratory-adapted colony of the Southeast Asian malaria vector Anopheles dirus COVID-19 and risks to the supply and quality of tests, drugs, and vaccines Parenting interventions to prevent violence against children in low- and middle-income countries in East and Southeast Asia Mapping the travel patterns of people with malaria in Bangladesh Estimation of incidence of typhoid and paratyphoid fever in Vientiane, Lao People’s Democratic Republic Factors affecting the electrocardiographic QT interval in malaria Prevalence of group A Streptococcus in primary care patients and the utility of C-reactive protein and clinical scores for its identification in Thailand Performance of the Access Bio/CareStart rapid diagnostic test for the detection of glucose-6-phosphate dehydrogenase deficiency Transmission dynamics and control of multidrug-resistant Klebsiella pneumoniae in neonates in a developing country Economic considerations support C-reactive protein testing alongside malaria rapid diagnostic tests to guide antimicrobial therapy for patients with febrile illness in settings with low malaria endemicity Sensitivity of C‐reactive protein for the identification of bacterial infections in northern Tanzania Feeding practices and risk factors for chronic infant undernutrition among refugees and migrants along the Thailand-Myanmar border Forest work and its implications for malaria elimination Genetic variation associated with infection and the environment in the accidental pathogen Burkholderia pseudomallei Microbiology Investigation Criteria for Reporting Objectively (MICRO): a framework for the reporting and interpretation of clinical microbiology data Early life risk factors of motor, cognitive and language development Scrub typhus and the misconception of doxycycline resistance Short-course primaquine for the radical cure of Plasmodium vivax malaria Determinants of dihydroartemisinin-piperaquine treatment failure in Plasmodium falciparum malaria in Cambodia, Thailand, and Vietnam Quality of medical products for diabetes management Investigating causal pathways in severe falciparum malaria Improving the estimation of the global burden of antimicrobial resistant infections Spatiotemporal epidemiology, environmental correlates, and demography of malaria in Tak Province, Thailand (2012–2015) A population dynamic model to project the burden of undiagnosed diabetes in Thailand Nutrition in transition: historical cohort analysis among pregnant women along the Thailand–Myanmar border 1986 - 2016 Antimicrobial resistance in Cambodia “I can’t read and don’t understand”: Health literacy and messaging in a migrant population on the Myanmar-Thailand border Optimal duration of follow-up antimalarial efficacy in pregnancy on the Thailand–Myanmar border ‘Antibiotic footprint’ as a communication tool to aid reduction of antibiotic consumption Novel approaches to control malaria in forested areas of Southeast Asia Malaria morbidity and mortality following introduction of a universal policy of artemisinin-based treatment for malaria in Papua, Indonesia Antimicrobial-resistant Gram-negative colonization in infants from a neonatal intensive care unit in Thailand Spatial heterogeneity and temporal trends in malaria on the Thai–Myanmar border (2012–2017) Microbiology Investigation Criteria for Reporting Objectively (MICRO): a framework for the reporting and interpretation of clinical microbiology data Clinical characteristics and outcome of children hospitalized with scrub typhus in an area of endemicity Human population movement and behavioural patterns in malaria hotspots on the Thai–Myanmar border: implications for malaria elimination Community engagement, social context and coverage of mass anti-malarial administration The rise and fall of long-latency Plasmodium vivax How context can impact clinical trials The impact of targeted malaria elimination with mass drug administrations on falciparum malaria in Southeast Asia How can interventions that target forest-goers be tailored to accelerate malaria elimination in the Greater Mekong Subregion? Collider bias and the apparent protective effect of G6PD deficiency on cerebral malaria Optimal dosing of dihydroartemisinin-piperaquine for seasonal malaria chemoprevention in young children Tafenoquine versus Primaquine to Prevent Relapse of Plasmodium vivax Malaria Molecular characterization and mapping of G6PD mutations in the Greater Mekong Subregion Association of mutations in P. falciparum Kelch13 gene with parasite clearance rates after artemisinin-based treatments Optimizing respiratory management in resource-limited settings Effect of point-of-care C-reactive protein testing on antibiotic prescription in febrile patients attending primary care in Thailand and Myanmar The double burden of diabetes and global infection in low and middle-income countries Challenges arising when seeking broad consent for health research data sharing Complex interactions between malaria and malnutrition The arrhythmogenic cardiotoxicity of the quinoline and structurally related antimalarial drugs Anaemia and malaria Field detection devices for screening the quality of medicines Valuing the unpaid contribution of community health volunteers to mass drug administration programs Enumerating the economic cost of antimicrobial resistance per antibiotic consumed to inform the evaluation of interventions affecting their use Important antimalarial drug DHA-piperaquine safe to use Addressing challenges faced by insecticide spraying for the control of dengue fever Risk-based reboot for global lab biosafety Comparison of the Cumulative Efficacy and Safety of Chloroquine, Artesunate, and Chloroquine-Primaquine in Plasmodium vivax Malaria Small children and pregnant women may be underdosed with widely used antimalarial drug Scrub typhus point-of-care testing The ethics of using placebo in randomised controlled trials Primaquine pharmacokinetics in lactating women and breastfed infant exposures Malaria Study analyses antimicrobial resistance surveillance networks in LMICs Acetaminophen as a renoprotective adjunctive treatment for patients with malaria Mass drug administration to stop multi drug resistant malaria in Cambodia Promising approach to reducing Malaria transmission by ivermectin Single low-dose primaquine for blocking transmission of Plasmodium falciparum malaria Community participation in mass anti-malarial administrations in Cambodia Ethics, regulation, and beyond: the landscape of research with pregnant women Estimating the burden of scrub typhus Estimating the burden of scrub typhus Quantification of the association between malaria in pregnancy and stillbirth Infection with Burkholderia pseudomallei – immune correlates of survival in acute melioidosis Community engagement for the rapid elimination of malaria Geographic resource allocation based on cost effectiveness Influence of number and timing of malaria episodes during pregnancy on prematurity and birthweight Migration histories of multidrug-resistant tuberculosis patients from the Thailand-Myanmar border, 2012–2014 First-trimester artemisinin derivatives and quinine treatments and the risk of adverse pregnancy outcomes in Africa and Asia An epidemic of dystonic reactions in central Africa Harmonised Zika virus research protocols published Birth attendant training course may be global model for safer birth care in poor communities News Units & Departments MORU Bangkok Malaria & Critical illness Microbiology Clinical Pharmacology Mathematical and Economic Modelling (MAEMOD) Bioethics & Engagement Epidemiology Clinical Therapeutics Unit (CTU) Clinical Trials Support Group (CTSG) Operations & Administration SMRU (Thailand) Humanitarian activities Research activities Our team Significant achievements Future vision SMRU website LOMWRU (Lao PDR) Our team Significant achievements Medicine quality LOMWRU Annual Reports COMRU (Cambodia) COMRU team Significant achievements COMRU Future vision Contact MOCRU (Myanmar) MOCRU Team Malaria & Critical illness Microbiology Clinical Pharmacology Mathematical and Economic Modelling (MAEMOD) Bioethics & Engagement Epidemiology Clinical Therapeutics Unit (CTU) Clinical Trials Support Group (CTSG) Research Areas Malaria Mother and child health Microbiology & non-malaria infections Critical illness Medicine quality Medicine Quality Research Group COVID-19 pandemic Statistics, data & modelling Bioethics & Engagement Our team Publications Researcher Podcasts Work & Study Job opportunities Training Students MORU Students COPCOV COPCOV COVID-19 COPCOV trial COPCOV at a glance Let's find out together COPCOV study sites COPCOV information for participants Contact us COPCOV News COPCOV Investigators SEBCOV study SEBCOV publications COVID-19 News COVID-19 Reporting MOTIP MOTIP | negative |
Image caption Ad hoc drinking may mean we do not actually know how much we are consuming
The amount of alcohol consumed in England could be much higher than previously thought, a study suggests.
University College London researchers compared alcohol sales figures with surveys of what people said they drank.
They found there was a significant shortfall with almost half of the alcohol sold unaccounted for in the consumption figures given by drinkers.
This suggests as many as three-quarters of people may be drinking above the recommended daily alcohol limit.
The researchers reached their estimates by factoring in the "missing" alcohol - and found excess drinking was far more than suggested by official figures, they told European Journal of Public Health.
Experts said much alcohol use went unreported, partly because drinkers did not admit or keep track of how much they consumed.
'Health implications'
The study found that 19% more men than previously thought were regularly exceeding their recommend daily limit - and 26% more women.
Total consumption across the week was also higher than officially thought - with 15% more men, and 11% more women drinking above the weekly guidelines.
The current recommendation set by the UK Chief Medical Officers is not to regularly exceed four units per day for men and three units a day for women; the Royal College of Physicians recommends weekly alcohol limits of 21 units for men and 14 units for women - although these are currently under review.
A unit of alcohol is roughly equivalent to half a pint of ordinary strength beer, or nearly one small (125ml) glass of wine.
Sadie Boniface, lead author of the study at University College, said: "Currently we don't know who consumes almost half of all alcohol in England. This study was conducted to show what alcohol consumption would look like when all of what is sold is accounted for, if everyone under-reported equally.
"The results are putative, but they show that this gap between what is seen in the surveys and sales potentially has enormous implications for public health in England."
The team used alcohol sales data from Revenue and Customs and compared it with two self-reporting alcohol consumption surveys conducted in 2008 - the General Lifestyle Survey (GLF) which analysed average weekly alcohol consumption in 12,490 adults, and the Health Survey for England (HSE) which looked at consumption on the heaviest drinking day in the previous week among 9,608 adults.
Counting units
The researchers say they will now look at the characteristics of those that are under-reporting the number of drinks they have had, and why.
They suggest it may be down to drinking patterns and habits - those that are mixing drinks, and drinking at different venues, may be more likely to under-report.
Media playback is unsupported on your device Media caption Alcohol Concern's Eric Appleby: "Particularly when we drink at home, we pour much larger measures"
The charity Alcohol Concern suggests irregular and chaotic drinking behaviour may play a part: "When we're totting up our drinks total we don't always count some occasions as proper drinking.
"We may underestimate drink sizes and their alcoholic content, and not count holidays and special occasions like weddings, birthdays and Christmas when we often drink a great deal more than usual."
The researchers suggest that government drinking guidelines need to reflect actual consumption instead of reported drinking - especially when ascertaining what levels are associated with harm.
The Department of Health says this will be taken into consideration in their alcohol consumption review.
It said: "We already know people underestimate what they drink and many drink too much. That's why we work to help people make healthier decisions, including the recent Change For Life campaign to help them track consumption and understand the impact on their health.
"We're also tackling excessive drinking through our proposed minimum unit price at 45p per unit, tougher licensing laws, more GP risk assessments, better access to specialist nurses and more specialised treatment."
Diane Abbott MP, Labour's shadow public health minister, said: "This has got to be a wake-up call for the government and the country, because after more than two years of bitter internal rows, the government has got cold feet about its only proposed alcohol harm policy.
"More needs to be done to tackle problem drinking, which costs the country £21bn." | positive |
Sitemap The South GA Seed Company Est. 2012 Search Sign in or Register () close Sign in or Register Heirloom Vegetable Seeds Asparagus Beans Beets & Chard Broccoli, Cauliflower, & Brussel Sprouts Cabbage Carrots Celery Corn Cucumber Eggplant Greens Kale Lettuce & Endive Okra Onion & Leeks Parsnip & Salsify Peanuts Peas Pepper Radish Rhubarb Rutabaga Spinach Squash & Pumpkin Tomatoes-Indeterminate & Determinate Watermelon & Melon Herbs & Flowers Seed to Sower Restoration Project Safe Seed Pledge Our Story Store Info. Customer Service Blog Store Policy & Disclaimer Seed Saving Guide F.A.Qs Privacy UGA Planting Calender Peter Henderson Vegetable Planting Chart A Journal of Heirloom Gardening Gift Certificates Sitemap Pages Home Seed to Sower Restoration Project Safe Seed Pledge Our Story Store Info. Customer Service Blog Store Policy & Disclaimer Seed Saving Guide F.A.Qs Privacy UGA Planting Calender Peter Henderson Vegetable Planting Chart A Journal of Heirloom Gardening Categories Heirloom Vegetable Seeds Asparagus Beans Beets & Chard Broccoli, Cauliflower, & Brussel Sprouts Cabbage Carrots Celery Corn Cucumber Eggplant Greens Kale Lettuce & Endive Okra Onion & Leeks Parsnip & Salsify Peanuts Peas Pepper Show All Brands South GA Seed Company Close × OK Newsletter Signup Email Address Footer Start Categories Heirloom Vegetable Seeds Herbs & Flowers Gift Certificates Information Seed to Sower Restoration Project Safe Seed Pledge Our Story Store Info. Sitemap Brands South GA Seed Company View All Heirloom Vegetable Seeds | South GA Seed Co. South GA Seed Co. Ellijay GA 30540 United States of America © 2022 Heirloom Vegetable Seeds | South GA Seed Co. Powered by BigCommerce Theme by Weizen Young | negative |
It was like nature itself was rebelling against the awful series of events that had taken place on this horrid day in history. The clouds in the distance, which had been predicted to be small and fluffy, or simply not there at all, were now unexpectedly gloomy and grey, a slight drizzle fell from them in certain areas.
Some solace was still apparent however, as the sun had decided to show itself for the event, right at the last few minutes. Toffee, fearing that the sun would blow his cover, decided to move from the hollow crevices of the Crystal-Pine tree to the relatively safer giant rose bushes, which towered above all else and obscured all light from falling inside. From there, he waited and watched, careful not to make a single noise, lest the guards find him and spike his head on the fluffy cake for the kicks.
He cursed under his breath, if he would be captured because he'd been enough of an idiot to listen to Midthios's pleas, then- Toffee stopped, noticing that things were finally moving along.
The various guests were gathered around the lavish celebration in the Castle Gardens, all gossiping and some admiring the beautifully bred roses that flooded the parklike area. There had been rumors that them and other flowers had been embowed with the magic of the wand by the Princess, who had always loved roses in particular. If not for the menacing, if tired looking, guards holding keep nearby, it would almost have been certain that some prebunctious guests would have stolen some for themselves, possibly taking the specimens for their own families and Kingdoms.
Despite the already gorgeous setting, Mewni had apparently seen the need to cover every last bare spot of the Gardens with tables and treasure and pillars of knowledge and conquest and glory. Truly, a botanist's nightmare. Even the guests seemed to be walking decorations, as even the poorest of the invitees wore lavish velvet and silk clothings, all shaped to the fad of the week. Most of the more wealthy guests wore even more outrageous dresses and suits, until it got to the point where many of them struggled to move or even clap their hands when told to. And of course, all of them wore some sort of violet and purple in their vestments, especially the other Royal families that had taken time out of their busy day to attend the ceremony. Purple was the royal color, after all.
Speaking of the other Royals, most, if not all of them were assembled for the momentous occasion. There were the Ponyheads, of course, with their proud King, who, coincidentally, was as violet pigmented as he was stubborn. With him came his entire family, save his wife whom had taken ill. Coming in with their fearsome fire and brimstone, the Lucitors were dressed the fanciest of them all. King Brandon Lucitor especially, his simple tie alone must have been carefully weaved by hand, with the most rarest of materials that could have been found in his dark and fiery Kingdom. In addition to the…. Non Mewmen Kingdoms, there were also a few Mewmen Kingdoms, none of them quite as prominent as Mewni, however.
With all the frivolous and festivities of the big event, you would expect the Princess of Mewni of all beings to be the most lavish of them all, perhaps branding a willowing dress that spoke for her, so she could spend all the time fixing the makeup that could change her very appearance at a whim.
But, to both Toffee's disappointment and relief, the "Rebel Princess" was not nearly as suffocated as he had expected her to be. She, of course, was still one of the most well dressed in the Garden, but she wore relatively modestly compared to what she could have wore. Most of her dress was an odd, pure pearly white, with a hint of dark blue around the edges. Toffee realized that she had been intentionally avoiding the color purple, as it probably disgusted her that the commoners of Mewni lived in destitute and ruin compared to the Nobles and Royal Family, whom wore the most rare and expensive pigment like it was nothing. Even without all the decor of a proper Princess, she still retained some sort of beauty, although more inner in nature. He wore a faint smile for the rest of the proceedings, although was scowling at the vows.
The priest standing behind a gold encrusted podium clapped his hands, and all went still and silent except for the Princess and a certain other Mewmen Prince, who more than made up for Eclipsa's lacking in fashion.
"Eclipsa Butterfly, Queen of Mewni, Protector of the Royal Mewmen Wand, and Light of the Kingdom, do you take Prince Galvin of the Phoenix Kingdom, third son of King Literyis the Valiant as your faithful spouse from now to death, from now to forever?"
Eclipsa's expression said it all; a dull grey look upon her face, all business and no room for anything else of the sort. Toffee could admire that moxy that she carried herself with, everywhere she went.
"Yes." she said simply, her hands clenched tightly on her abdomen. Toffee stared, something clicking in his mind.
Toffee didn't stick around for Galvin to respond, he succinctly slid through the tight gates of the main circle of the wedding, attempting to avoid any wandering eyes. He had made it to the far right end of the Gardens, which was full of gorgeous and towering white fountains, some almost as big as Midthios. His heart skipped a beat once as he accidentally brushed up against a young girl's shoe. Holding his breath, Toffee instantly rolled right into a relatively small but deep fountain, burying himself at the very bottom, away from any scrutiny.
The girl screamed, her mother and father then turning in surprise. Blubbering on about a 'snake', her parents silently comforted her in their arms. Toffee let out a small sigh of relief, then deciding to wait until all the guests had moved on from the general vicinity of the fountain.
Grumbling under his breath, Toffee knew that it was easier said than done. It would be many hours too late by the time he could see a viable opportunity, Eclipsa and Galvin had already left, and so had many of the royal families. The sun too, was beginning to dip down, and the beautiful three moons of the Mewni Dimension rose up in its place. Toffee slowly floated up to the surface of the fountain, air bubbles drifting monotonously around him.
Sighing in pure annoyance, he heaved himself out, shaking his saturated scales and soaked leather armor. At this point, he was too tired to make any semblance of security, as he shambled to the gates of the Garden, fumbling with the hard iron bars as he attempted to climb over the very pointy parts of the gate.
He was about halfway up, just getting the hang of coordinating his claws and the almost nonexistent ridges in the gate, when he heard a slightly hushed up yell, one he may not have noticed if not for his enhanced hearing. Toffee froze, keeping his entire figure still, not daring to look behind him and face the voice that had seemingly tracked him down.
He would either have to make a run for it, or, if the situation allowed, take the Mewmen behind him with him, as to not arouse any suspicions of an armored stranger fleeing the Wedding Garden. But then, Toffee realized, the Mewmen's disappearance would only add to the suspicious events that night. Unsure of what to do, he waited. Suddenly, the Mewmen spoke, her voice surprisingly familiar, although Toffee couldn't exactly place who it was.
"Pardon me?" she asked in a quiet, almost frightened voice."I don't think you're supposed to be here."
Toffee scoffed,"And what are you doing here?"
Immediately after that question, the girl gasped in surprise,"You…. Your voice! I recognize you from- Well…. A place."
It all came flooding back to Toffee. The nagging remembrance of the girl revealed itself like the snap of a jester. This girl… She was the Princess! She was Eclipsa…
Great. Now she's going to find out.
Toffee sighed, knowing that it was useless to hide anything now. He carefully stepped down the gate, keeping all eyes tracked on the Princess. Surprisingly, she wasn't very well dressed for the cold weather, seemingly wearing nothing but a small but thick robe. Upon further inspection, it came to Toffee that the robes Eclipsa was wearing were but pajamas. He had to chuckle from the absurdity of it all.
Eclipsa blabbered on, her eyes widening ever so slightly, "And- You're a- Lizard…."
"Look, Princess," growled Toffee,"You have a few options here. Well, actually, I'm lying. You need to come with me. My friend would most definitely like to see you."
Hoping to all hell that he wasn't making a horrible mistake, Toffee and Eclipsa silently made their way out of the Gardens, this time with the fashionable slight of Eclipsa's 'short cuts'. They slugged their way out of all semblances of civilization, the Gardens being only a few treks away from the furthermost reaches of the luscious Tangleweeds, which grappled and wavered around Toffee and Eclipsa, possibly sensing that the resulting gathering that was about to occur could not, and should not be stopped.
Unlike its more prominent neighbor, the quirky named: Forest of Certain Death, the Tangleweed Forest is of a quiet nature. While the Forest of Certain Death isn't exactly loud or rambunctious, it does always have a creature growling in the background, or the raucous noise of a poisonous waterfall cascading in the mist. But the Tangleweed Forest is always silent, except for the pit pat of visitors that sometimes drift into the Forest, most of whom are never to be seen again. Coupled with its almost instinctive abhorrence for Mewmens, the Forest is a perfect place for a Monster or two who wish to hide out the rest of their miserable existences.
While Toffee and Eclipsa were walking, Eclipsa suddenly shuddered to a halt, her eyes glued to the sight before her, which had been revealed with the passage of the mist. It was nothing too spectacular on its own, it was just a simple grass thatched hut, with a single window. It all seemed very normal to Eclipsa; the commoners of Mewni lived in very similar rentings.
What was off was the simple enormous scale of it all. The entire hut was gigantic in size, every last bit of it seemed to be specifically tailor made for a being at least three times as tall as the tallest Mewmen Eclipsa knew, which was her father.
While Eclipsa simply stood there silently, taking it all in, Toffee crept to the door, his stature sizable enough to just barely grasp the doorknob. Instead of pulling the door open however, he merely called out in a slithering soft voice,"Midthios? We…. Have a visitor."
A few small stepping sounds later, Eclipsa came face to face with perhaps the least expected person she could have guessed. A mildly dressed man, with coral tinted hair stopped out from a door that was way too large for his rather timid stature.
Both of their mouths dropped as they instantly recognized each other. Only a few moments after making eye contact, both of them snapped back to Toffee, Eclipsa frightful and the man with an angry expression.
"Why is Malik here? Did you capture him?"
"Toffee, why would you bring her here?!"
Eclipsa turned back to "Malik", an inquisitive feeling gushing over her. "Malik…. Do you know this Toffee fellow?"
He sighed, putting his hands to his face bitterly. "Yes…. No… Look. Let's just forget this happened. I understand it's been a tough week for you, but…"
Eclipsa scowled,"Why is it always like this with you? You always say these things like my problems don't matter! And now you apparently know this monster, who I'm pretty sure I've heard before!"
Smirking wildly, Toffee stepped in between the two,"Ladies, ladies, I can settle this. Eclipsa, this is Midthios. You might know him as Malik, but that's just him during the night. In the day, however…" Toffee looked up at the sky, which was unfortunately full of clouds. However, the sun was clearly far from rising. "He's a bit taller then he is now."
Eclipsa frowned at Toffee before turning back to glare at Midthios,"So…. Who are you, really? Seeing as how this 'Toffee' fellow is a monster, I would be forgiven for assuming you to be a monster as well!"
Midthios rubbed his chin and stared blankly at Eclipsa. After taking a quick glare at Toffee, he sighed and sat down, motioning for Eclipsa to sit down with him. She accepted his invitation, although reclusively.
"I guess it's too late to lie now," he said, clenching his fists."It's true. I am a monster."
Toffee waited for the gasp of surprise and resentment that was sure to come out of Eclipsa in waves, but it never came. She was surely the adaptable one.
"Hmph," Eclipsa said, sliding into eye level with Midthios. A smirk grew on her face,"So…. You're like a Wereboar. But… Different, somehow? Tell me you aren't a Wereboar."
Midthios snorted,"No. I think my bipedal body structure carries through with both of my forms."
They shared a laugh, then a warm mutual glance, their eyes lit aglow with soft embers. However, both Midthios and Toffee could recognize an odd atmosphere to Eclipsa; her breathing was rather deep and frequent.
Eclipsa sighed, sitting down on the wet, dark grassy ground, her feet crossed and expression exacerbated,"Now. Can you explain…. All of this?" Eclipsa waved her hands around the forest, and then at Toffee,"Why…. Me? What else have you been lying about?"
Midthios clenched his fists,"Not much else. For the most part, I've been completely honest. I never wanted to lie to you, but I knew that you wouldn't accept me for who I was."
Eclipsa scoffed,"Seriously? You think that matters to me, whether you're a Mewmen or a Monster? Besides, what about him?" she jabbed a finger towards Toffee, who was reclining onto a tree, his eyes raised."I know I've heard his voice before."
Midthios was silent. Instead of answering, he turned to Toffee, with a pained look in his eyes,"Why, Toffee? Why did you bring her here? What good could possibly come from her learning about us? We'll have to move out of the forest before Mewni's Knights come for us."
"Hey," Eclipsa said, frowning deeply,"I'm not going to sell you out, you know."
Midthios rolled his eyes, putting his arm around Eclipsa shoulders,"That's what they all say… Before they get you." he suddenly jabbed his hand at Eclipsa's back, causing her to nearly jump in surprise, then looking behind herself with scorn.
Sighing in frustration, Toffee stared silently and blankly at the squabbling couple. His dead serious eyes caused both of them to freeze, looking back at him, concerned. He spoke, his voice quivering as the light of dawn and the falling darkness of night seemed to coincide with each other.
"I brought us here together because…. Eclipsa is pregnant. And I don't know who the father is."
For a moment, every last living thing within a mile radius of the three of them seemed to go still and silent, all was stopping in the world as the gears of shock and fear started to turn slowly in Eclipsa and Midthios's heads, the rust flaking off and corroding their innards with a sickening feeling. And then after the first blast, another one hits, one vengeful at oneself for even thinking such dark feelings about what, in another time, in a more civilized place, may have been a happy moment.
Finally, Midthios spoke, perhaps with a hint of apprehension in his voice,"What do you mean,'I don't know who the father is?'"
Classic Midthios. Toffee thought, Always missing the bigger picture.
"As I'm sure you know, as you sent me to it instead of going there yourself, the wedding of Princess Eclipsa and Prince Galvin of the Pheonix Kingdom, out into the north, has came and went." speaking in a monotone voice, Toffee still somehow managed to gravitate the attention of both Eclipsa and Midthios.
"I noticed during the proceedings that Eclipsa wasn't wearing any luminous or frivolous clothing. Now, at first I assumed she didn't want to use a wasteful and expensive dress that she most likely would have never used again after the wedding. But what if that wasn't her reason? What if she was merely attempting to keep her unborn child, the heir to the throne of Mewni, unsmothered under the weight of an ungracious gown? Additionally, I observed her as she took her vows, she had been clutching her stomach. Furthermore, I've begun to notice that she's been wearing more air loose clothing. Her mannerisms and posture basically confirm it. She's pregnant. Care to refute me?"
Silence.
Eclipsa was glaring at Toffee, her expression one of pure distaste,"What exactly is your point here? If I was somehow able to conceive a child with Mali- Midthios, then there is no need to have such a deteriorating tone."
Good, pondered Toffee, his eyes glued to the Princess, She's as smart as she looks. That's either going to save her life, or ruin it.
"The thing is," began Toffee,"You've been in an arranged marriage with this Prince for a considerable time. More than enough time to consider betraying your 'true love'. As far as I know, it's impossible for a Mewmen and a Monster to procreate, and, at the very least, the track record for Mewmens deceiving Monsters is much better."
Typically, this would be the point when all would go silent, and someone, someone, would say something validating and meaningful, something that would be the final nail in the coffin. More often than not, this was how Toffee's true battles ended. That was how he knew he had defeated his enemy. How he knew he had an enemy.
But that was not the case.
"Are you done?" Eclipsa snapped, her fists slamming against her kneecaps, almost smudging up her pajamas. "How dare you think that I would even consider cheating on Malik with that disgusting, half souled, snobbish-" she calmed down for a bit, her gaze disheveled. "Not only that, but although I've been in my arranged 'marriage' for almost a year now, I have only ever been with him in person twice, once when we were introduced, and then at the wedding. Come on, say that I'm lying!"
Toffee didn't say anything. Midthios stood up instead, his eyes still not purified, fueled by jealousy."Why didn't you tell me? Why wouldn't you tell me that you were pregnant?"
Eclipsa snorted,"As if I had a chance. I wasn't the one who said you'd be at my wedding, five months in advance, and not even show up."
Midthios and Eclipsa both stood still for a few moments, their eyes scanning each other. Finally, it was like a long tempered fire was burning brighter than ever before. They embraced, right as the sun climbed over the horizon. Midthios's transformation was about to begin. Eclipsa closed her eyes in trepidation.
When it was all done, and she opened her eyes, the first thing she saw white. Just white, pure, snowy thistles of hair. The skin was obviously of a much redder complexion. And if Eclipsa had been able to see his face, she would have seen two pairs of eyes and a tooth filled smile.
Midthios murmured quietly,"Am I hideous?"
Eclipsa replied in typical Eclipsa fashion,"Nope."
Everyone and the universe had just taken a deep breath of relief. But there were still questions unanswered. How the two of them were going to handle a Monster - Mewmen hybrid, Toffee wasn't sure. He wasn't even clear if he even wanted to know what it would look like…..
Toffee remembered Eclipsa's response to his speech, which would normally crush someone. He had tried. He really tried. Gazing into those dark, but ensouled, eyes, he had hoped to see something - anything - that would push her case over the edge. But there was nothing to be seen. Nothing at all. There was nothing Toffee could say. Eclipsa had gotten him completely twisted up like a Swamp Dwelling Bog Snake. It was terrifying.
Toffee had finally met his equal. | positive |