Datasets:

gursi26

/

wikihow-cleaned

like 2

give yourself a pep talk . wait until the right time . act natural . just do it .

how to approach your crush 1

before walking right up like a bundle of nerves , take a moment to collect yourself . breathe slow and deep to the count of ten to help yourself relax . remind yourself of your best qualities and make those the ones you display to your crush . whats the worst that could happen if you dont talk to him or her , youll regret it , and that first spark could just be the start of something fantastic . which of your characteristics are you most proud of can you get along with anyone are you athletic do you have a good sense of humor keep these traits in mind when working up your nerve to talk to your crush , and give them the chance to get to know the good things about you . its possible that you feel intimidated by your crush if theyre extremely attractive or popular , but for all you know they may feel the same way about you . seeing your crush surrounded by his or her friends might make you even more nervous . try to find a time when theyre alone and nearby when you can start a conversation without having to worry about being interrupted or met with other judging eyes . look for your crush between classes or another time when theyre less likely to be with a big group . create a scenario that will give you an opportunity to make the introduction . if your crush drops something you might return it to them , for instance , or if you see him or her talking to a mutual friend you could use the connection as an icebreaker . taking advantage of little openings will keep you from appearing desperate or having to walk up and start talking out of the blue . be enthusiastic , but keep your cool . dont let yourself appear overly excited . if you have a class with your crush , ask them to clarify the details of a homework assignment as way of opening communication . chances are , that anxious feeling you get before talking to your crush is never going to disappear entirely , so at some point youll have to just take a deep breath and go for it . seize your opening when it presents itself . start by introducing yourself if you havent met , or by asking a question to get them engaged if youre already acquainted . getting the conversation started is usually the scariest part , so once thats out of the way you can carry on the interaction at ease . boldness often pays off . you wont know if the person you have a crush on is also interested in you unless you talk to them . make peace with the idea of rejection . your crush will probably be happy to talk to you once you get the ball rolling , but in the event that things dont go as you hoped , just shrug it off . its always better to try and strike out than live with never knowing with what might have happened .

respect your crushs boundaries . explain that you need some time to recover . unfollow or block your crush on social media . stay away from places you think your crush may be . avoid asking your friends about your crush . avoid entertainment that reminds you of your crush .

how to accept that your crush doesnt like you 2

dont try to change your crushs mind or prove to them how great you are . this might get on their nerves , and worse , it will make you feel a little pathetic . save your energy for someone who likes you , and leave your crush alone . remember that there are many reasons your crush might not be interested in you . maybe theyve liked someone else for a long time , or maybe they like you as a friend but dont think youd be a compatible couple . it doesnt mean theres anything wrong with you . if you are friends with your crush , its normal to feel a little awkward around them after getting rejected . let them know that you need some time away from them to get over your feelings . if they are a good friend , theyll understand and respect your wishes . if you arent really friends with your crush , you dont need to explain to them that youre taking some time away from them . in fact , its probably better if you dont . resist the urge to stalk your crush online by unfriending or unfollowing them on the social media platforms you use . if youre worried about caving in and re - following them later , block them . you can always re - add them in the future , once youre over your feelings . dont try to get a glimpse of your crush in the hallway at school or in the break room at work , no matter how tempting the idea may be . put as much distance as you can between yourself and them . if you have to see your crush every day , try to sit far away from them and avoid conversation . be polite . its okay to say hello if you happen to see your crush , but dont linger or try to start a conversation . if you and your crush have mutual friends , let them know that youre trying to get over some feelings , and ask them not to talk about your crush around you for a while . dont ask what your crush is up to or whether theyre dating anybody , since this might re - ignite your old emotions . music , movies , and books can all be helpful in getting over an unrequited flame , but stay away from entertainment that helps you wallow in your feelings . if certain media makes you think about your crush , cut it out for a while and replace it with something that isnt so emotionally loaded . try indulging in escapism for a while . look for novels and tv shows that transport you to worlds very different from your everyday life .

accept your feelings . find support . make a list of your good qualities . think about your crushs negative traits . express yourself creatively . practice good self - care .

how to accept that your crush doesnt like you 3

admit to yourself that youre feeling bad about getting turned down . theres nothing wrong with liking someone , and rejection is something almost everyone has experienced at some point . the sooner you come to terms with your feelings , the sooner you can heal from them and move on . seek out the company of people who value you , like your friends and family . its okay to cry or talk your problems through with them , especially at first , but try to have some fun with your loved ones too . a day out with your pals or a visit with extended family can do wonders for your mood and self - esteem . sit down with pen and paper , and spend a few minutes brainstorming all the reasons someone would be lucky to be with you . include overall positive traits like kindness , as well as little quirks like always remembering someones favorite foods . save your list so you can look at it when you feel down about yourself . nobodys perfect , and your previously rosy view of your crush might have hidden their bad qualities . now that you have a bit more distance from them , think of everything that bothers you about your crush , from their weird laugh to their inability to remember your name . youll be feeling less love - struck in no time . channel your feelings into your writing , drawing , music , or any other kind of art you like to make . you can show other people your finished work , or keep it private – its up to you . your heart and ego are probably feeling a little bruised , so be gentle with yourself as you recover . cut yourself a bit of slack at school or work . instead of burying your sadness with endless movie - and - takeout sessions , do your best to eat well and get some exercise , and treat yourself to things that make you feel good about yourself . for instance , you could spend an afternoon at your favorite coffee shop or get a new haircut that you love .

do some mental preparation . talk about them . highlight your common interests . know when to break away .

how to approach your crush 2

think about what you should say to your crush before you get them talking . have a certain topic in mind that youd like to discuss , and be prepared to answer any question he or she might ask about you . that way , youll be primed and ready to make a good impression during your first interaction , and youll have less chance of being caught off guard . be ready for whatever turns your first meeting may take . your crush might be tired , busy , distracted or nervous , and these moods can affect the way he or she comes off . one surefire tactic for keeping someone that youre talking to for the first time interested is focusing the conversation on them . typically , its easier for people to talk about themselves because they already know what to say . show an interest in your crush and let them talk about themselves , relating to them when you can . this will also give you a chance to get to know a little more about them . ask questions . itll make your crush feel like you have a genuine interest in them , and it can also take some of the pressure of thinking of things to say about yourself . you should talk about yourself , of course , but dont steal the floor entirely . try to keep things even , or let him or her take over and guide the conversation . listen when your crush talks about his or her hobbies , interests and preferences and see where they overlap with your own . the more things you discover you have in common , the more the two of you will have to talk about . finding common ground could even help create an opportunity for a date or more casual hangout later on . some good topics for finding out what you have in common are what classes youre taking , movies , music , sports , family and your plans for the weekend . keep track of how long youve been talking to your crush to make sure youre not holding them up , and pay attention to when they seem to be losing interest . unless you really hit it off , your first couple of interactions might not last too long , and its better if you can lend yourself a sense of mystique and leave them wanting more . excuse yourself with a phrase like talk to you later or text me sometime youll want to make sure they have your number first to let your crush know that you want to talk to them again . get a feel for natural lulls in the dialogue and look for an opportunity to make a smooth exit when things start to slow down , just as you made a smooth entrance . dont ramble on and on . the last thing you want to do is bore your love interest .

be confident . smile . freshen up . keep a positive attitude .

how to approach your crush 3

you wont get anywhere if you dont have faith in yourself . stand tall . let your crush see the things that make you interesting and unique . you should prepare to approach him or her with the attitude that youll love and respect yourself no matter the outcome . confidence is contagious—your crush will pick up on your self - assured manner and know that youre someone worth being around . sometimes you just have to fake it until you make it . if youre having trouble mustering the gumption to walk up and say hello , tell yourself that youve done this kind of thing a thousand times . it may just make you a little cooler under pressure . theres a difference between being confident and being arrogant . stick with the former . try not to boast or act like youve got an over - inflated opinion of yourself . this can be just as off - putting as being shy , if not more so . dont forget to smile , even if youre a nervous wreck . smiling can help put you at ease and make you more comfortable , and a friendly face will make you more approachable to others . keep in mind that your crush may be just as apprehensive about talking to you as you are about talking to them , so greeting them with a smile will break the tension right away . smiling can be tricky when youre especially nervous . try a light smirk with your eyes open slightly wider than normal to signal enthusiasm , and grin bigger to show a little bit of teeth if your crush does something cute or amusing . aside from your demeanor , you appearance will also be one of the first things your crush notices . for this reason , its a good idea to make sure youre presentable before making your move . bad breath , unkempt hair and messy clothes can all be deal - breakers if you want to make a good impression . give yourself a look over in the mirror before you enter your crushs personal space . tick off a short mental checklist to make sure that your teeth are brushed , youre wearing deodorant and your clothes and hair are clean and well - groomed . the most important thing to remember about approaching your crush is that its the effort that counts most , not the result . rejection is a fact of a life , something that everybody has to deal with at one time or another . the excitement and satisfaction of finally talking to that special someone should be bigger than the fear of being turned down . its not the end of the world if the guy or girl youve got your eye on doesnt return your interest . it may sting a little at first , but dont let yourself become discouraged . even if you get turned away while trying to strike up a conversation with your crush , you may still reach a breakthrough in building the confidence you need to try again next time .

know what a crush is . know that there are different kinds of crushes . figure out how serious your crush is .

how to recognize that you have a crush on someone 1

urban dictionary defines a crush as a burning desire to be with someone who you find very attractive and extremely special . crushes make you feel crazy emotions - - like feeling shy and uncontrollably giddy at the same time . you cant always choose who you have a crush on , but you can choose how you react once you figure out that you have a crush on someone . the term ‘crush gets thrown around a lot . it can mean that you simply have a passing infatuation with someone , or that you really like him or her . the friendly crush sometimes called a squish it is important to remember that not all strong feelings are romantic . letting yourself trust someone and become really close to someone , without necessarily having romantic feelings for them , is a really special thing . wanting to be around a person all the time may just mean that you have gone from friends to best friends . its totally normal to have a friend crush - - you should want to hang out with your bff as much as possible . the admiration crush when you idolize a person like a celebrity , teacher , or classmate who has done something really cool you may realize that you have really intense feelings about that person and what they have done . these feelings might be mistaken for romantic feelings simply because they are so intense . feeling slightly awed in the presence of someone who has done something amazing or can teach you great things is natural . often , its best to let a bit of time pass before really thinking too hard about these feelings . generally once you have spent a lot of time with this person , you will have learned a lot from them and may begin to feel like you can stand on equal ground . you may find that your crush - like feelings simmer down once the initial awe of being in their presence wears off . the passing crush it is human nature to be attracted to other people . even if you are in a great relationship , you still might find that you feel attracted to someone other than your romantic partner . this attraction is what we call a passing crush - - this new person may seem new and exciting , and they probably are , but that doesnt mean you should reconsider the relationship you are in or , if youre single , drop everything to try to be with himher . often times , passing crushes are spiked by being attracted - - most often physically - - to someone . the romantic crush sometimes having a crush on someone really does mean you really , really like them - - and in a romantic way at that . having a romantic crush means that you want to be with that person in more than just a friendly way - - you want to be their romantic partner . if you fantasize about kissing , holding hands with , or cuddling with that person , you probably have a romantic crush . by doing this , you can figure out how best to proceed - - whether you should keep your feelings to yourself or share how you feel with your crush . read the next sections to help you figure out just how strong you are crushing on that special someone .

act moderately occupied . you could do this in many ways . pretend the person is not there . appear slightly amused by the person . ask yourself , whats the worst that can happen , announce what youre doing . say hello to your crush . be friends with their friends . be yourself with a pinch of wild . separate your idea of them with reality .

how to act normal around your crush 1

the important thing is to show the person you are crushing on that you are not ready to give into them right away . have a few supplies with you , to occupy yourself , for when you see your crush like a book or a magazine a pen and a sketchbook a cell phone a large part of having a crush involves some degree of ignoring someone . dont go out of your way . if you appear to be unaffected by this persons presence , youll appear to look normal . this can be a difficult step if youre head over heels . do not make it too apparent that you are trying to ignore them . it could be obvious if youre trying too hard . stay calm and collected . when you see them do not gaze at them too directly . play with the circumstance by giving them sly looks and then appear distracted by looking around the room . try to give off a slight smile on your face and in your eyes if they catch your eye contact . this is a great calming method that hits at the core of why you dont feel normal . the worst possible outcome from appearing awkward and nervous around your crush is not life threatening . by accepting the larger picture of the world , you may be able to relax about your feelings towards your crush . a lot of people feel like the social microscope is fixed on them , but the reality is that most people are concerned about themselves . people are not watching you and looking for an opportunity to scrutinize you . you dont want to ask your crush if they want to hang out . if theyre nearby , talk with youre friends about your plans for the weekend . if youre in a situation where youre talking to them about your plans , dont ask them to join you . theyll seek it out if theyre interested . you could even talk about how you and your friends are trying to get a big group together for yada yada . then make it obvious that they could come if they ask . it is normal to acknowledge people . nothing detrimental will happen if you give them a casual hello , or even just a wave or smile . saying hi or hey with a smile can potentially stir their world . it is the most casual thing you can do if you meet eye contact . youll seem collected and the pressure is now in their court . making friends with your crushs friends might alleviate your nervous feelings by closing the distance between you and them . talk to your crushs friends like a buddy . theyll remember you as being cool and might speak highly of you to your crush . dont flirt with any of them . you dont want them to think youre interested or they might develop a crush on you . dont be afraid to call a little attention to yourself . this can improve your confidence level , if you choose to wear something that makes you feel good and attractive . this is one way that might spark their attention . if you go over the top , they could become intimidated , but if this is the case , then rethink this crush . dont be afraid to be yourself honesty is the best policy . it is common to project what you want to see in your crush , as opposed to who they really are . nobodys perfect , but it could help you get a better grip of yourself by knowing some of their flaws . dont get too nosy or they could find out and become alarmed .

consider your behavior around the person you think you might have a crush on . consider how you feel around your potential crush . notice how you act around your friends and your crush . decide whether or not youre putting more effort into your appearance .

how to recognize that you have a crush on someone 2

paying attention to your physical behavior means noticing how you react instinctively when your crush is around . different people will react differently , and generally it will be a subconscious reaction . generally , when you have a crush you will react in one of two ways - - either by becoming really shy and tongue - tied , or by becoming really outgoing . the shy reaction do you suddenly feel like you might like to curl up into a ball when your crush is around do you blush incessantly and cant seem to raise your eyes up from that suddenly very interesting speck of dirt on the ground do you suddenly feel like you dont have anything witty or interesting to say all of these reactions point towards having a crush . the outgoing reaction do you suddenly feel the urge to tease your potential crush when they are around , do you get the sudden urge to talk a lot because you want their attention these are all symptoms of a crush as well . just make sure that you dont make your crush uncomfortable if you act this way - - try not to tease them too much or they might not want to hang out with you . the flirty reaction do you feel like you want your crush to notice what you are wearing or how your hair is done that day do you feel like giggling and joking around maybe you suddenly feel the urge to make sure you look as good as possible so that your crush will notice you . batting your eyes , flipping your hair over your shoulder , and playing with your hair are all signs that you have a crush . the most common sign of having a crush is the feeling that you have a million butterflies flying around inside you when that special someone is around . it can also feel like your heart does a leap when you see your crush and you feel warm and giddy . do you suddenly feel nervous but excited at the same time maybe you feel like you want to hug that person or be with them all the time . these are all normal reactions to having a crush . do you feel like you would give up anything to be near that person having a crush can cause you to suddenly want to be the star of the conversation , or not talk at all when your crush is around . if you are talking with a group of friends and the person you think you might have a crush on walks up do you do the following things , what do you doif so you have a crush , you will probably do one of the following do you suddenly feel like you need to be the center of attention you might find yourself directing the conversation so that you can talk about something cool you did in an attempt to impress your crush . you may even talk over one of your friends so that your story can be heard . you might also try to make as much contact with your crush as possible , keeping their attention on you . do you suddenly feel like youre tongue - tied having a crush can sometimes make people feel embarrassed and like they dont have anything to say . if you are normally talkative but suddenly clam up when that special person is around , you most likely have a crush . do you feel like your friends sort of disappear when your crush walks up you may be surrounded by people but suddenly all you can see is your crush . you might smile a lot , even if what your friends are talking about isnt funny . if your friends asked you something , would you have a hard time paying attention to the question because youre focused on that special person these are all signs that you have a crush . a major sign of having a crush on someone is wanting to look nice around that person . do you spend more time getting dressed in the morning have you bought new clothes you thought your crush might like do you spend an extra amount of time getting your hair or makeup just right , just in case you see your crush that day if so , you most definitely have a crush .

consider whether or not your crush is all you think about . notice whether or not you talk about your crush a lot . consider whether or not youve changed anything about your life with your crush in mind . pay attention to your internal reaction when someone brings your crush up in conversation . pay attention to your daydreams . notice if things remind you of your potential crush . consider your thoughts while reading this article .

how to recognize that you have a crush on someone 3

if you find yourself , thinking about that special person more than you think about anything else , you most likely have a crush . perhaps you are at dinner with your family but you arent paying attention to the conversation because you are wondering what your crush is doing . maybe youre hanging out with your friends but secretly you wish that you were hanging out with your crush . when you are going to sleep at night , do you think about what it would be like to kiss your crush goodnight do you find yourself bringing that person up in conversation with your friends all the time a major sign that you have a crush is when your friends tell you that you talk about that specific person all the time . if you feel comfortable doing so , it would be a good idea to talk to your best friends about thinking that you might have a crush on someone . they can help you figure your feelings out and might have some ideas about how to get to know your crush better . be careful who you talk to about having a crush . dont just go blabbing to any random friend about your crush . if you do that , someone might tell your crush and then you might get embarrassed . only tell your best friends - - the friends you can trust the most . do you have any habits or patterns you have gotten rid of or changed in the hopes of getting your crushs attention do you walk by their locker a million times in the hopes of seeing your crush have you changed the path you take to class because you know heshe walks that way you have taken a new and deep interest in a subject that you know your crush is interested in , like photography or rock climbing . often , when you have a crush , you will feel excited when your crush gets brought up in conversation . if someone mentions your crush in passing do you feel excited suddenly get that feeling like a bunch of butterflies are flying around your stomach feel like your heart might leap out of your chest blush and giggle get tongue - tied and flustered if any of these things happen , you have a crush on someone . there is a difference between thinking about someone and daydreaming about someone . thinking about someone means you wonder what that person is doing , or how heshe is feeling . daydreaming is when you fantasize about things that you want to happen . people who have crushes on other people tend to daydream about their crushes a lot . if you daydream about that certain someone and imagine you two going on adventures together , holding hands , kissing , or anything romantic like that , you most likely have a crush on that person . being reminded of that special someone when listing to a song , watching a movie , or reading book is a definite sign that you have a crush . if you listen to a romantic song and think , ‘hey , thats how i feel you have a crush . if you watch a movie like titanic and envision you and your special someone as jack and rose , you have a crush . if you read romeo and juliet and immediately identify with the hopelessly deep love of the main characters , you have a crush . while reading this , has there been one specific person on your mind while reading this article if you answer yes , it means you have a crush on that person .

dress in flattering clothes that make you feel comfortable . check your breath . groom yourself regularly . try to learn as much as you can about your crush . hang out in a group at first . talk less to keep some mystery about yourself . start slow by saying hello regularly . make eye contact . keep your conversations short , at first . find something you have in common . ask for help with something . let your sense of humor shine through . be a tease . ask interesting questions . recall a previous conversation . get to know your crushs friends .

how to act around your crush

you should always wear what you feel comfortable in , dont just wear something to impress you crush or fit in . wear clean clothes that make you look your best if you know youre going to be around your crush . just dress naturally . some people might get intimidated if you try getting really dressed up around your crush . you want to act naturally and be yourself , not like youre something youre not . focus more on clothes that help you feel confident . if you want to impress your crush , youll do it with your personality , not with your shirt . make sure your clothes fit well , are clean , and make you feel good . if youre going to be around your crush , bad breath could be a turn off . make sure you that you brush regularly , especially after meals , and keep some mints , gum , or other little fresheners around in case you need them . breath strips act quickly and are easy to carry around in your pocket , so you dont have to be chewing gum constantly while youre trying to flirt . check in the mirror after meals to make sure you dont have anything stuck in your teeth . that could be embarrassing after the fact . again , you dont need to be a movie star to attract your crush , or to act naturally around them , but its a whole lot easier to be relaxed and confident around someone if youre not worried about the smell youre putting off . shower regularly and take care of basic body stuff so you can feel confident . if you have acne problems , talk to your parents and your doctor about prescription solutions . there are lots of stronger medicated facial soaps out there to try . dont suffer in silence . put some thought into your hair and basic grooming . you dont need to be glammed up all the time , but dont look like you just rolled out of bed . hanging around someone youre attracted to can be hard if you dont know much about them . you might want to impress them , or come off like an attractive and interesting person , but what do they think is attractive what do they think is interesting the more you know the answers to these questions , the more comfortable you can be . get to know them on social networking first . reach out on facebook or twitter and become friends , or start following them on instagram to get some sense of their sense of humor and style . talk to mutual friends to find out things like whether or not your crush has a partner already , or whether or not your crush might be interested . its a lot easier to chat up someone who you think might like you . one - on - one hangouts can be challenging . if youre trying to hang out with someone , do it in a group , so your crush can see how you act naturally around your friends , instead of trying to do it all at once . invite your crush to hang out with your friends , or just to sit with your friends at lunch . there doesnt need to be a reason . alternatively , you might feel more comfortable hanging out one - on - one . if you do , try to find reasons to hang out with your crush solo , even in a non - date type of situation . just try sitting together on the bus , or working on homework together , or sitting together at lunch . lots of people make the mistake of thinking that you need to talk a lot and make a big show if you want to attract someones attention . not necessarily the case . hang back a little and make your contributions magnetic and more meaningful when you do talk . talk more quietly , so everyone else needs to quiet down when you speak . turn to your crush and lean in when you have something to say . make it meaningful . itll be mysterious and personal . your crush might be attracted to more flamboyant , loud , or chatty people , and thats ok . that doesnt mean you need to change who you are to attract them , or get to know them better . its important to let your crush know that you exist , and that you like talking to them . when you see your crush walking down the hallway at school , or passing them in public , smile brightly , wave your hand , and say hi . use their name out loud . this little gesture goes a long way in making someone feel valuable and wanted . this isnt a sign that youre crushing on someone , its just a sign that youre nice . if you see someone you like , say hello . when you like someone , making eye contact can do more than a couple thousand words and a bunch of love letters . when youre hanging out , or having a conversation , make eye contact and use gentle body language to seem more approachable . use open body language around your crush , keeping your shoulders back and your arms uncrossed . dont stare at someone you like . catching someones eye and smiling is one thing , but gawking at someone you think is attractive during class will just come across as creepy . when youre first getting to know your crush a little better , try to keep your interactions brief to avoid any awkwardness or difficulty in talking . just chat up someone about the class you just had , or have a brief talk about your weekend plans , then say , well , nice talking . see you later . dont worry too much about having really deep or interesting conversations . itll happen as you get to know someone better , which takes time . nobody has great conversations at first . give them a chance . dont know what to talk about try to figure out something that you have in common and can share together . talk about a class youve got together , or an assignment , or talk about an upcoming sports event at your school . find something you can shoot the breeze about . dont think too hard . if you live in the same town , or go to the same school , youve automatically got a little in common . talk about your neighborhood . gossip about common friends . complain about teachers . online is a great way to find out simple things like this . if you know your crush watches a certain show that you like , talk about the last episode , or your favorite characters , or what you think is going to happen next . one good short - cut to starting a conversation is to ask your crush if theyll help you do something . ask for a hand with some homework assignment youre working on , or ask for some help setting something up in gym class . even if youre fine on your own , itll be a chance to have some time to talk . go with a little white lie if you need to have you seen my math book over here i just had it , and i cant find it . will you help me look then chat while you try to find it . when you never can , say , thats ok , youre so sweet for helping . i like talking to you if you want to get to know someone better , and maybe even get them to like you , its a good idea to let your sense of humor out as much as possible . laughter is infectious , and people like being around people who are funny . even if youre not a class clown , you can still have funny conversations with your crush . dont say , hey , hows it going thats a boring conversation to start . instead , say , im thinking of busting out of this prison . so far all ive got is a calculator and half a snickers . what do you think can i count on you youre not going to tell the cops right if your crush says something like , youre weird , then you know theyre a boring or stuck - up person . dont waste your time getting to know people who dont share your sense of humor . some studies show that gentle teasing can cause magnetic reactions in people , causing our brains to attract where we might naturally reject . people dont want to be put on pedestals and complimented all the time . this is boring . this is also while lots of nice people are rejected by crushes who are looking for something more interesting . that doesnt mean you should be a jerk , just that you should learn to let your sense of humor out in gentle ways . if you see your crush put up a bunch of selfies on facebook , tease them about them . ok , there are a lot of these , so im going to help you rate them one by one , in terms of what it looks like youre thinking . this one says , oh wow my room smells like corn - dogs . people like for conversation to be easy . if you want to put your crush at ease and get them talking , asking creative , engaging , or even silly questions is the way to go . treat it like a fun conversation game . say this is your last day on earth . where do you go first what do you eat what do you do who do you hang out with whats on the ipod its important to avoid prying or coming off like youre insensitive . dont ask questions that are none of your business , like , your dad doesnt look like he makes a lot of money , how is your family doing not sure what to talk about follow up on something that you already talked about . if your crush mentioned a big event one weekend , follow up and ask how it went the next time you see them . try to remember the things you talk about , so youll have a store of new conversations to pick up on . if your crush mentioned a book , show , or movie last time that you were unfamiliar with , check it out and talk about it the next time you see each other . be honest and offer your opinions . if you want to get to know your crush even better , its important to engage with their group of friends . treat your crush as a close friend , and try to hang out in your crushs circle of friends as much as possible . invite your crush to hang out with you on group events as well . try to get your crush to hang out in a group with your friends , so itll be more comfortable and fun . get to know your crush in a group . find out what your crush likes , what your crush thinks is funny , and what your crush is like to be around . this can help make your conversations a lot more natural and fun . lots of people talk about the friend zone being a bad idea for a potential date or relationship . if you like someone , its good to get to know them , every time . dont worry about befriending someone for a while before you get closer .

recognize you are crushing . ask them to hang out . evaluate their character . invite them to hang out with your friends .

how to act normal around your crush 2

this can be a difficult realization because typically crushes are linked to romantic feelings . this is not always the case . an identity crush is someone you come to view as a leader . this causes you to want to identify your attributes to theirs . this type of crush opens more doors for developing a friendship . you dont need to act uninterested or half - amused . simply ask them to do something you know they like to do like play music go bowling play golf see a movie play laser - tag go tubing sometimes identity crushes can be for the wrong reasons . lots of time people aspire to be the popular kids in high school , but sometimes the popular kids arent good people . if youre ever faced with hanging out with a new clique and cant invite youre old friends , then weigh your options . this is a great opportunity to hang out with them when you are in your best element . make sure your crush and friends are both okay with this plan . this will give your crush the chance to see how you normally act with your friends .

practice talking to other people . talk to a family member . keep a journal . do extracurricular activities .

how to act normal around your crush 3

you dont have to wait around for the perfect chance to say something to your crush . you could always ask a random person that you find cute for a stick of gum . talking to people youre attracted to will improve your comfort level when talking to someone you really have a crush on . being at home can be a hard time when youre heels deep in a crushs spell . your parents can offer valuable advice because they went through what youre going through . if youre not comfortable talking to your folks about it then ask a cool uncle or a sibling youre open with . sharing what you are going through help elevate pressure you feel when youre near your crush . writing out your feelings and ideas can be a great therapy . whether you write memories , letters , or your personal thoughts , you are practicing an expressive process that strengthens your physiological growth and health . it is important to face your emotions by yourself . it is a good time to reflect on how this crush is only a person . write whatever feels right . dont concern yourself with typos or grammar , this is for you . if you have friends or a younger sibling around , you might consider keeping this in a private location . staying after school for clubs or sports could be a great way of distancing yourself from your crush . playing sports will especially help by pushing yourself both mentally and physically . staying too stagnant will not help you act normally around a crush . think of exerting yourself as a way of releasing your frustrations . this is a good way of dealing with nervousness on a larger scope . physical activity improves your mental state in your everyday life .

plan to do something exciting together . pick a time and place that sets the mood . pay attention to your grooming . talk to her . bond with her on a deeper level . learn to read body language . make physical contact . time it right . take the lead . be sensual and not overly aggressive or sloppy . learn to deal with rejection .

how to get a kiss from a girl you like

the adrenaline rush you experience when doing something novel or challenging gets your heart racing and is similar to how you feel when you get a crush on someone . the best part about this is , she will associate the feeling of excitement with you and it may help create a heightened sense of romantic interest in you . not only are couples who engage in exciting activities significantly happier in their long - term relationships , but being in an excited state of mind also increases sexual arousal in the short - term as well . go on some rides together before you are alone together . ski , hike , dance or to a concert—anything that will get the adrenalin flowing for both of you . evening often works the best because dim lights and darkness has been found to increase attraction , communication and connection , physical contact and sexual arousal . plus , special or new surroundings are sure to make the kiss more memorable . the location might be outside under the stars , in a candle - lit restaurant or a dark gym during lunch , but make sure the two of you have some privacy . she may not want an audience . while you will want to dress in clean clothes , brush your hair and look good for your date , dont forget to pay special attention to your oral hygiene . brush your teeth , and dont eat anything strong or stinky like garlic before and during your date . you can also bring along breath mints or gum just in case . youll want your lips to be soft , so bring along some lip balm or chap - stick as well . wear red . it makes men seem more attractive and sexually desirable . your goal is to become friends , so youll want to find things to laugh about together and discover things that you have in common . read up on some funny jokes or make up your own and tell her . laughing is a good way to break the anxiety and awkwardness of first dates . start with small talk about the weather or a teacher you have in common . compliment her on her hair , clothes or smile . get to know her personal preferences by discussing movie scenes or songs to get an idea of what kind of things she likes and how she feels about romantic encounters . keep your face tilted up when you talk to her as this makes you seem more masculine and attractive . you want her to feel comfortable and connected to you—more so than her other guy friends . sharing emotional and personal information can really create a very strong and lasting connection . women often use kissing to bond and reinforce that bond . some questions or prompts to ask in order to enhance bonding are describe a perfect day . what do you feel most grateful for in your life what is the greatest thing that you have accomplishment in your life what memory do you treasure the most what is your worst memory if your house caught on fire and you only had time to save one item family and pets are already safe , what would it be show her that you like her by smiling and looking into her eyes . let her know how you feel . she may not know that you want to be more than friends , so the best thing you can do to avoid being stuck in the friend zone is to tell her you want more . youll want to pay special attention to how she reacts to you to decide ifwhen you should go for the kiss . positive body language tells you that she likes what you are doing , while negative body language tells you that she dislikes it . look for combinations of either positive or negative behaviors that let you know how she feels . positive body language can be shown when she moves towards you , points her feet toward you , uncrosses her legs , keeps her arms open and palms up , playfully fondles her jewelry or hair , smiles or maintains eye contact . negative body language may mean she moves away from you , points her feet away from you , keeps her legs and arms crossed , palms down , hands closed , fidgets , frowns or turns her eyes to the side . if you are getting a lot of negative body language , then you should probably change your approach or try again at a better time or when she is in a better mood . if she make a lot of body contact with you , such as touching your hand , rubbing against your knee , gently bumping up against you , tapping you on the shoulder or holding your hand , then shes probably into you . to get close enough for a kiss , you have to enter her personal space and see how she feels about it . it takes trust or expectation to allow you to get closer , and if shes ok with it , you know you have a good chance of getting that kiss . additionally , touch reinforces that you are interested in her and that you enjoy making contact with her . be a gentleman . pull out her chair at a restaurant and push it back in after she sits down . this gives you the opportunity to gently touch her on the shoulder , arm or upper back . hold her hand . if she doesnt pull away from you , then you know she likes what you are doing . adjust her hair . touching her hair is intimate without being as personal as a kiss and will allow you to see how she feels about you . if she flinches or moves away , then shes probably not ready or interested in a kiss . if she seems to like it , then you can take the next step toward that first kiss . try a kiss on the cheek first . lean in and give her a peck on the cheek to see whether she offers positive or negative feedback . then you can decide when its time to try a real mouth - to - mouth kiss . you will want to build up to the moment and find the right time to break the tension with a kiss . dont wait too long , though , or she may think you arent interested . when you are both close , touching regularly , maintaining extended eye contact , showing positive body language , and you are not being distracted , take your chance . the right time for the two of you may be toward the end of the first or second date , but its better to do it sometime before the end of the night so youre not sitting in the car or standing in the doorway awkwardly . be spontaneous . an incredible kiss happens when everything falls into place . it does not have to be at any specific point during your time together . it could happen before you enter a restaurant early in the evening , across a dinner table , in a theater , or just while taking a stroll under a full moon . try not to ask first . asking permission shows a lack of confidence and can ruin the moment . her body language should tell you when shes ready , but if you really arent sure , you can ask . when kissing , assertiveness is attractive , so commit and go through with it . look at her lips , wet your lips for lubrication , turn your head slightly to the rightand lean in for a closed - mouth kiss . wait for a moment so your partner can meet you half - way . use touch to make the kiss more interesting , such as holding her cheek or head , brushing her hair back , touching her neck or cuddling . though you may maintain eye contact until she returns the kiss , its best to close your eyes once your lips touch . the initial kiss is best closed - mouth without a lot of saliva exchange , and keep your tongue in your mouth . kiss for a few moments , and pull away when she does . you can still maintain physical touch and eye contact , though . nows the time to follow her lead and match her movements and passion . listen to her breathing to see if she is enjoying the kiss and to ensure you are letting her get enough air . sometimes the girl you want to kiss is just not interested , and you will have to move on . recognize that its probably not your fault she doesnt want to kiss—maybe she has a lot on her mind , is already in a committed relationship or just ate garlic for lunch . dont make over generalizations about the fact that this girl didnt want a kiss . realize that being rejected in this one particular situation with this person does not mean that it will happen again with someone else or that there is anything wrong with you . its important to know that what happened does not say anything about your self - worth or value as a person . give yourself some time to get over your feelings for this girl and try again with someone else that you like .

start slowly . rub your tongue over your partners lips . ask him to french kiss you while you are kissing . let him know if its the first time . be patient .

how to ask your boyfriend to french kiss 1

you should try to get your boyfriend in a romantic mood first , and lower the pressure with a few slower , warm up kisses first . make these a few soft pecks after its clear hes in the mood to kiss . perhaps your boyfriend will start french kissing you without being asked if you seem receptive enough during the first kisses . the best approach is to wait a bit and see if it happens on its own . you will know he wants to kiss you when you make eye contact , and one or both of you moves closer to the other . tilt your head to the side , and part your lips . gently draw one of your boyfriends lips between your own as you kiss so your lips interlock a bit . dont be afraid to tilt your head a bit as this will signal renewed interest . you could say , lets go slow to be clearer to your boyfriend , especially if he is inexperienced at kissing or you are . you could also acknowledge your nervousness by saying something like , hey , im a little nervous . are you too he may appreciate your honesty . remember , he might be just as nervous as you are . if hes a more experienced kisser , telling him something like , i love kissing slowly at first can help set the mood . because french kissing involves kissing with tongues , if you rub your tongue over your partners lips , it will give him the signal that youre ok with french kissing . do this lightly because it will be romantic to your partner and a bit teasing . thats good . sometimes your boyfriend might feel insecure and is looking to see if youre all right with it . you could say something like , you have really nice lips as you rub your tongue over them , looking him briefly in the eye . feel free then to gently push the tip of your tongue into your partners mouth . if your partner has any experience , he will probably then move his tongue deeper into your mouth . you could just come out and ask remember that hes probably nervous too . if youre kissing slowly and gently at first , more nibbling than french kissing , you could take a small step back , look him deeply in the eyes , and say , id love to french kiss you right now , but im nervous because ive never done it before . could you show me how or you could say something like , want to try french kissing i would love to try that with you . if youre worried about bad breath , just make sure you pop a mint or brush your teeth or spray mouth freshener into your mouth before the kissing starts if youre really nervous because youve never french kissed before , its ok for you to tell him that . find the right place and time , which is when you are both alone and comfortable with each other . it might feel embarrassing at first , but he will probably appreciate your honesty , and it might excite him to think that he will be the first person to french kiss you . its a good idea to have this conversation before you actually are kissing . find a casual way to say it . for example , while youre driving in a car or eating dinner together , you could say , this is hard for me to say , but ive never french kissed before maybe you can show me how later . dont make it overly serious . you could also start the conversation with a question by asking him if he knows how to french kiss . this might entice him to show you how to french kiss . remember that the best relationships are built upon a foundation of strong communication anyway . its best to wait until youve been dating for a little bit before you have this conversation , though . what if your boyfriend is not ready for french kissing thats ok . everyone needs to go at his or her own pace . your boyfriend might just be nervous , so dont read too much into it if your boyfriend hasnt french kissed you unless youve been going out for months . in that case , you could ask why your boyfriend feels that way . if the relationship is new , you could just let the french kissing happen naturally . let your boyfriend take the lead on it , and if hes not ready work on building your bond and connection by sharing time together and great conversations , rather than forcing the kissing .

try to make sure you really like this guy , and if hes even worth your time . start getting to know him better . find common interests . joke around and carry a sense of humor . flirt , ask questions . ask him if hes busy during the weekend . give him gifts . ramp up your flirtatious behaviour . ask personal questions . get him to be comfortable around you . if he had an ex , find out if hes over her . tell him about your ex . hint to him that youre interested . ask him out on a date . text and e - mail him . and once you guys have hung out and finally gotten to know a lotbut not everything about each other , pop the question , have you ever pictured us , you know , together , if the guy says i dont feel like i want to take us to next level right now . and if the guy says yes the first time , be cool about it . if he doesnt like you , dont take it personally .

how to get the boy you like to go from total stranger , to friend , to boyfriend

if youre looking for specific traits in someone , ask a friend or even take the time yourself to see what this boy is all about . you dont want to waste your time on someone who isnt who you think he is . whats the point of that spend some time talking to him make your goal at least once every other day . you dont want to seem obsessive , but you dont want to appear too afraid to talk to him either . do you both love rock music what about basketball its always helpful to know what this guy is interested in , and even if you cant find anything you two have in common , try to get interested in what he likes . who knows he might not end up liking you , but you could find a new hobby . make him laugh and feel comfortable around you . however , make sure you avoid using any jokes that could offend him you never know what could happen . you dont have to go overboard , but the occasional sitting next to him or complimenting him can have a huge impact . the best thing to do in a moment of awkward silence . you can also start a conversation like this , especially if you want to get off of a topic other than yourself . this is also a great way to get to know him a bit better . consider inviting a few other people with you to avoid an awkward first date night . go to the movies or an arcade , or go and get some pizza . you should get him a birthday giftchristmas presents . nothing too big , though . when you guys have been talking for a while about 2 to 3 weeks start flirting with him a little bit more . touch his shoulder during conversation or look him right in the eyes when you two are talking . but dont look into his eyes in a weird or obsessive gaze or he will flip . once you guys start hanging out more often , ask more personal questions about him , and reply honestly when he asks you about your life , unless its something personal you dont want to spill , and be open to him . let him get to know you , but make sure not to take it too fast . dont tell him everything he needs to know about you in your conversations . let him nibble off the cheese and show him little tidbits of yourself . that way , youll have new conversations every time , and you wont be boring . boring topics are the free way to the check out list and avoid lying too . the truth will always find its way back to him , and it could end up embarrassing you . if its just you two , strike up a conversation casually , let him know that he can be comfortable with you in any situation . thats a great way to land him as your boyfriend . and always be there when he needs you . thats not just if you want to be bfgf , thats for friends in general . but its still a good tip . the first thing youve got to find out if whether or not hes still got a fire for his ex . if thats the case , you dont want him as a boyfriend . to find out , casually ask him . get him to talk about any feelings he has about her , whether theyre good or bad . get him to spit out about whether or not hes seen her recently , if they still keep in touch , etc . if you find that hes over her , then move on to step two . let him know in no vague terms that you are 100 over that person who broke your heart . guys are very easily deterred by women who are still hung up on an ex . dont come off like one of those women . thats the quickest way to make sure this guy that you like stays just your friend . let your guy friend know how much you highly think of him and how much you think he would make a great boyfriend for someone one day . hes probably so used to being nagged , debased and mothered by his ex that it will be refreshing to hear that you think he would actually make a fabulous boyfriend . but dont call it a date . in its place , invite him out to the movies one night as friends . if he asks you out the following weekend and you ask him about again , the next thing you know , you both will find yourself dating . send him comical text messages and e - mails . its a fantastic way to build your friendship and future relationship . guys want women they can be themselves with them . by letting all hang out , youre letting him know that youre fun and cool at the same time . do this when you two are alone someplace , you wont know if his answer is true otherwise . a lot of guys say no if theyre around their friends because , they dont want to attract attention from everyone else . they feel like theyre pressured to say yes , because , well , their friends will rag on them and drive him to no . he means , youre great as a friend , i just dont want to be bfgf right now . respect his choice , and then stay friends . dont act let down , because that will create an oddness between you two , which will set you back to almost strangers . and if one day , he says , hey , do you want to catch a movie with me you know , as a date then smileyou know youve been waiting and say , i thought youd never ask . and bite your lip . biting your lip gives you a look of excitement and anxiety which is a good look , because then the guy knows youre nervous too . do the same bite the lip routine . and , if he goes in for the kiss , enjoy every steamy moment of it . you cant say you havent known him for long enough , because you have , as a friend . that automatically gives you the right to kiss him right when he asks you out . but dont kiss him first , let him do the honors , and then , after a few dates , you can make the first moves all you want . there are more fish out there in the sea . youll find that one guy someday

make yourself kissable . lean in and make eye contact . hint that you want a kiss . consider taking the lead . invite him to kiss you . keep it gentle at first .

how to have a first kiss 1

not only will these tips help you feel more confident when you go in for a liplock , theyll also send subtle hints that youre ready to be kissed . wear lipstick or chapstick . skip the sticky lip gloss . keep your breath fresh . pop a mint beforehand instead of chewing minty gum , which youll have to find a way to spit out . smell amazing . before you meet up with your guy , shower off and use scented moisturizer or a few spritzes of perfume . lean your head on your guys shoulder as if you are about to fall asleep . look up at him - if his arm goes around to let you in , go for the kiss . if not , or if he doesnt seem to be taking things the same way you are , he might not be ready yet . just relax for now . there are a few things to do to plant the idea of kissing you like he thought of it . try these look at his lips . drop your gaze and your eyelids to half mast , then slowly , look back up at him and give him a little welcoming smile . reach up to twine your arms around his neck , or lightly play with the hair at his neckline . this will let him know you are ready to get up close and personal . slowly lean your face closer to his . moving in communicates that youre ready for more contact . some guys are very shy , and even those who arent have been drilled over and over about unwelcome touching . consider lightly kissing him on the cheek to show him that youre okay with touch , a lot of boys worry about going too far . yep , some guys really do need an engraved invitation . lets say youve tried to show him youre ready , and he looks interested , but you just cant get him to kiss you . say something like , couldnt we just be kissing right now if he doesnt kiss you then , he isnt going to . dont bring out the tongue , teeth or strong embraces on the first few kisses . instead , keep your lips soft and slightly parted , and avoid puckering . for more technique tips , see how to kiss .

prepare your appearance . make your lips kissable . freshen your breath .

how to get a 13 year old boy to kiss you 1

in order to obtain a kiss , you must appear attractive to the boy . although you want to look your best , be sure that you still look like yourself . otherwise , the boy may not like you for who you truly are . dress nicely . find clothes that suit your body and skin tone . select the colors that best complement you . although you should dress nicely , be sure that you appear modest and not over the top . you want your lips to look irresistible , not dry or cracked . start by regularly applying lip balm to keep your lips smooth and hydrated . try avoiding bright lipsticks or sticky glosses as it can get messy and ruin your kiss . another way to get soft lips is to gently exfoliate them with a wet washcloth and sugar . always keep a good lip balm on you just in case you need it . before seeing the boy you want to kiss , be sure to brush your teeth and rinse with mouthwash , especially after you eat . always keep breath mints or gum on you in case you need to freshen your breath if things look promising . try offering a mint to him , as he may take it as a hint that you want him to kiss you . dont eat strong smelling food like garlic or onions right before you see him .

make sure you have a fresh breath . make sure youre looking good . find a nice place to kiss . try doing something to break the touch the jitters away by flirting physically . make sure that you both are ready for the kiss . move your lips towards him slowly , closing your eyes at the last second . use mostly your lower lip for kissing . while youre kissing , try to go for a gentle open - lip kiss . during the kiss , put your hands around his back and lean towards him . as you move away from the kiss , open your eyes . say something nice about him , if you feel like it . listen to what your heart tells you . remember kissing etiquette .

how to kiss a boy for the first time

fresh breath is important for kissing because you want to give the boy as many excuses as possible to keep on kissing you . try using lifesavers or mints and always brush your teeth before you meet up with him . remember , bad breath isnt the end of the world but avoid it if you can . try not to eat strong , spicy , or garlicky food before you see him . again , if you cant avoid it , its not a huge deal but its better to avoid it altogether . you cant always plan when and where youll kiss a boy , but you can try to be prepared . if youre dressed pretty and in a way you feel comfortable , youll have a spring in your step . that means you will be more confident . more confidence means that theres a bigger chance the boy comes back to kiss you again . dont necessarily wear lip - gloss , and dont wear heavy lipstick . lip - gloss and lipstick , especially , will rub off on your partner , making him look sparkly or sloppy , depending on the situation . stick with lip balm instead . dont wear a bunch of accessories like hats , or wear your hair so that it gets in the way . boys like natural beauty anyway . you may want to try kissing the boy when you have your hair up , so that he focuses only on you and the kiss , not the hair tickling his face . public places are generally not so good for the first kiss , as you can get people staring at you or even heckling you . try to find a place thats public , but still intimate , for you to share your first kiss . this will not only make him understand that you like him , but will also give him some time to adjust to you , so that youre not going from 0 to 60 in a second . hold his hand or put your arms over his shoulders . start moving your body so that hes much closer to you itll be awkward if you have to move a long way to kiss him . touch his hair or face to make him know that you are interested . gently touch his nose with your pointer finger and smile at him . you can even try hugging him first , and while youre still hugging him , lean back and go in for the kiss . this creates a connection from the very moment you hug . this means both physically and emotionally . kissing says i like you more than just a friend , and its sometimes hard to save a friendship after you have a relationship . if youre not sure whether youre doing the right thing , wait until you absolutely know . look at him in the eye . while hes watching you , look slowly towards his lips and back again . if he does the same to you , then hes ready . if he looks a bit uncomfortable and looks away , its best to leave it for a while . you need to be able to see so that you can aim for his lips , but you dont want to keep your eyes open while you kiss , so close them right before your lips lock . keep your eyes closed during the whole kiss . when the kiss ends , you can open your eyes and you gently pull away . move into the kiss at an angle . that means if his face is straight up and down , you probably want yours tilted a bit to the left or right — whichever is more comfortable . this helps keep you from bumping noses together when you kiss . dont pucker up your lips like youve just had a bunch of sour patch kids , or like youre kissing grandma . keeps your lips loose and try to relax . give him one long kiss . you dont have to do anything fancy to get his attention the first time . your big goal is to get him to come back for seconds . give him just enough so that hes interested , not so much that hes bored . try to keep the first kiss to under 20 seconds if you can . breathe in and out gently through your nose . try not to breathe into his throat or onto his lips . dont french kiss on the first kiss . the french kiss is an advanced kiss , so save it for when you really want to blow his mind . this just means opening your lips a bit and maybe kissing his lower lip with both of your lips . dont make it last too long — about 5 seconds — and be prepared to pull away soon . that way , you can get double the bargain if he puts his hands around your back or waist , it means hes very protective of you and you could be onto a winner if he plays with your hair or gently strokes your cheek , its a sign that hes very in - touch with his feeling , and he definitely likes you . remember to try to keep your eyes closed the whole time . no peeking your attention should be entirely on his lips and the kiss . now would be the time to take a look at the boy youve just shared a kiss with . if you did a good job , hell be flushed , heavy - eyed , and smiling . smile back at him . he may be nervous about how he kissed , so youll probably want to convince him that he did a good job . you can do this by smiling . if you arms are still around him , leave them there for a few seconds before taking them away . it might feel weird if you suddenly take your hands away as soon as the kiss is done . sometimes , the kiss itself is enough of a statement . sometimes , youll want to say a little something after the kiss , like youre a good kisser . ive been wanting to do that for a long time . so , youve finally kissed the boy that youve been dying to kiss for the last six months . what now you have several options wait for him to make the next move . if you went in for the first kiss , maybe you think its his turn to initiate the next kiss . be yourself , do what you normally do , but be friendly and encouraging around him . he should try to kiss you again . kiss him whenever you want to . maybe you dont care that much about who kisses whom , as long as theres kissing . thats fine , just make sure that hes into it , too . kissing him often is likely to lead to a relationship . break off the kissing . maybe he wasnt that good of a kisser , or he touched you in the wrong place , or you just get a bad feel from him . thats ok . try to still be friendly around him , but dont put yourself in situations i . e . one - on - one , private setting where he could kiss you again . there are some unspoken rules that you should know about kissing . pay attention and try to follow them if you can and they make sense to you . dont kiss and tell . we know — its very easy to do . that doesnt mean its right . what goes on between you and your crush is between you and your crush . try not to gossip too much about it . dont kiss when you are sick and likely to spread germs . kissing is a very intimate thing , but that doesnt mean that your kissing partner wants every single part of you , including your cold . try not to kiss when you are feeling under the weather . kiss one person , not everyone . kissing may be fun , but that doesnt mean that it sends the right message to go out and kiss everyone you want . focus on one person you really like , try things out , and then move onto someone else if that doesnt work out . youll be appreciated a lot more , and youll probably be happier .

moisten your lips . start french kissing him first . deepen the kiss .

how to ask your boyfriend to french kiss 2

lick your lips so that they arent too dry . it will make him more likely to want to french kiss you if your lips look moist . use chap stick or lip balm . its probably best if you close your eyes for most of the kiss . its a little unnerving to most people if the person they are kissing is staring at them all of the time . open your lips while french kissing . angle your head to one side so that your noses dont bump into each other . its usually a good idea to start with other kisses rather than immediately french kissing him . never forget that youre not the only one whos nervous or a little insecure . he probably is too so if hes not taking the hint but seems into kissing you , you can initiative the french kiss yourself . start by gently pushing the tip of your tongue into your partners mouth in order to assess his interest . if he doesnt pull away , thats your signal . now find the tip of his tongue with your tongue . gently brush against it with your tongue . thats it youre french kissing once youve started the french kiss by touching each others tongues , if both are receptive , you can deepen the kiss . french kissing is very intimate and a way to bond with your boyfriend . simply move your tongue deeper into your partners mouth to make more contact . a good kiss is a long one in which both tongues are touching . thrust your tongue into his mouth with a little bit more forcefulness . if hes as passionate about you as you are with him , he will likely move his tongue deeper into your mouth too , touching your tongue with his .

kiss sensitive areas on his face . become a great kisser . try not to use too much tongue .

how to ask your boyfriend to french kiss 3

you dont want to only french kiss endlessly . break it up now and then with a little sensual kissing in other ways . for example , some men or boys have very sensitive ear lobes . try kissing his ear lobe , his jawline , and his neck , and see how he responds . embrace him . if your boyfriend seems to like this , you can move back and forth between such sensual kissing and french kissing . he will likely find it very tantalizing there are a few key tips to making yourself a better kisser . for one , no one wants to kiss someone who doesnt take care of his or her breath . so make sure your breath is fresh and your mouth is clean . pop a mint , brush your teeth , use mouthwash , or buy those little mouth freshener strips that dissolve in your mouth or mouth freshener you spray into your mouth if youre looking for something portable . go slowly . dont think you have to pummel his mouth like a jack hammer . the best kissing usually lets the intensity build and then dissipates before building again . be sensual . go slow . one mistake that beginning kissers make is they think they have to shove their entire tongue down their partners throat . you dont . you can just push your tongue into his mouth a little bit and let it dance around . then thrust it in , but not so far that it feels like you are gagging your partner . breathe through your nose when kissing . try not to get saliva all over him . when youre done with kissing him , wind it down back to the little warm up kisses rather than just suddenly stopping .

get confident . clean up and look kissable . respect her privacy . watch for signals . make eye contact . break the touch barrier . draw her in slowly . go in for the kiss . walk that fine line and make it a really excellent kiss , one that is romantic , tender and memorable . end it gently .

how to have a first kiss 2

youve got this so act like it . dont slouch , shy away from her , mumble , or refuse to meet her gaze . instead , show her that youre comfortable with yourself and she can be comfortable with you , too . make eye contact , speak clearly , and generally act like youre confident . if you look as appealing as possible , you wont have to work quite so hard to convince her youre worth a kiss . shave . or dont . most girls prefer a guy with a smooth face , but some like their guys face rough . get to know what your girl likes . keep some mints handy . pop one whenever you feel your breath getting stale . try to be as generally clean as possible . take a shower , put on some clean clothes , and wear deodorant and if you want , a bit of cologne . many girls and women will not want to make out in front of others , especially if this is her first kiss . find the right time when you can be alone . privacy is key . watch carefully , because sometimes the signals can be confusing - she may flirt with you , then smack you on the head . these may just be coy games , or she may really be conflicted . ask yourself these questions did you and your date seem to have a cozy , warm , close time together has she been flirting with you through body language has she licked her lips , or bit her lower lip while looking at you has she found excuses to touch you often if you feel confident of these things , prepare to kiss if she is comfortable and doesnt look away , then she is ready . lock eyes when youre talking to her , when shes talking , and during moments of silence . starting with small physical contact tells her whats coming and gives her the chance to back out if shes uncomfortable . try these if youre not sure what to do put your arm around her shoulders hold her hand sweep her hair away from her face . reach around her waist with one or both arms , and gently draw her toward you . if shes interested , shell get the hint and move in if you feel her resist , though , back off . do not squish her up against you and then grind your pelvis against her . do not use a first kiss as your personal excuse to grope , grab , or get too familiar . be a gentleman . once shes close and youre pretty sure she wants to be kissed , its time to seal the deal look into her eyes . notice how we mention eye contact twice very important . let her know that you are really seeing her . look at her lips . aim , dude . make sure you know where youre going . lean in slowly , and gently brush your lips over hers . dont worry about fancy technique or going quickly on the first few kisses — you can deal with that later . your mouth should not be overly opened or closed , and it shouldnt be mushy or too tight relax . dont let it go too long more than , say , 20 seconds or let it be too short 3 seconds is not enough - think around 10 seconds or so . a tiny hint of tongue is nice if she seems willing , but make it flirtatious and not insistent . check out how to kiss for more technique tips . just remain silent and hug her , ending the first kiss in a lovely , intimate moment .

spend time with him . drop hints . smile at him . initiate closer contact . stare at his lips and eyes when you talk .

how to get a 13 year old boy to kiss you 2

the first step to getting a boy to kiss you is to be friendly and welcoming . if you are not already friends with him , introduce yourself and try to regularly communicate . this will create a closer relationship between you and him , and allow him to develop physical feelings for you . try to keep conversation light and fun . you want to be a desirable person to spend time with so that he wants to get closer to you . sometimes , when a boy wants to kiss you , he might be too uncertain of your feelings to make the move . giving him hints that you want a kiss from him may be just what he needs to do it . laugh at his jokes , ask him to spend time with you , and let him know you think he is cute . here are a few things you can say you are so funny . it is so fun spending time with you . i really like your shirt today . you look so good in it . whenever you see him , or he tells you a joke , be sure to show him your best , come hither smile . try grinning , and look at him flirtatiously at the same time . this will help to boost his confidence to kiss you . show him you are interested by playfully touching his hand , shoulder , or face . when you touch him , it will signal to him that you want to get closer . when you greet or part ways , give him a long , tight hug . by giving him deep eye contact , and then looking at his lips , it will alert him that you may have kissing on your mind and are looking for a kiss from him . you dont have to look at his lips the whole time , but keep moving your eye contact from his eyes , down to his lips , and back up to his eyes when you talk .

pick a good location . find a good topic to talk about . flirt with him to show you want to kiss . lean in close to his face . make your move and kiss him .

how to get a 13 year old boy to kiss you 3

the location helps to set the right mood for intimate encounters . dont choose places like loud parties that may make you feel under pressure , or places in public that would be awkward . instead , find a secluded area in order to create a good setting for you to make your move . whether youre taking a stroll in the park or heading off somewhere , be sure that you both are away from people . he will be less likely to kiss you if there are others watching him . wherever you choose to be , make sure you can talk and see one another easily so that you he can gauge your kiss - me vibes . if you are having trouble getting him alone , tell him , i want some fresh air . would you like to come with me for a positive conversation , open yourself up to a variety of subjects in order to keep him interested . be sure that you have a list of topics or questions to discuss with the boy . while its important to listen to him , you must also talk in order to have a successful , fascinating conversation . when youre talking , initiate light contact by touching his arm . make eye contact in order to appear interested in what he is saying . smile at him once in a while to assure him that you are comfortable around him . dont hesitate to tease him lightly or laugh at his jokes . keep your flirting subtle to avoid scaring him away . half the battle of kissing someone is getting close to their face . if you keep a close proximity to his face , then he can more easily gather the courage to kiss you . if he is not being forward enough , you may have to initiate the kiss . be sure that the mood is light and happy . smile at him before moving closer to him in order to show that you are open to him . look up into his eyes for a moment , smile , and glance down at his lips . if he doesnt move forward , lean forward and lightly press your lips to his .

be honest about the situation . put yourself in her shoes . tell her what you plan to do . respect your friends emotions . tell your crush your feelings . keep the situation with your friend private . take things slow . be discreet with your actions . nurture your friendship . wait until shes moved on to gush . if your new boyfriend sends you a dozen roses and writes you a sonnet , its only natural to want to spill all the details to your friend however , you should just wait .

how to cope when you both like the same guy and he might like you

it might be scary or intimidating , but put all of your thoughts and feelings on the table . if you really like this boy , tell her . if hes hinted or flat out told you that he returns those feelings , tell her . while it may hurt your friend at first , it will feel worse if she feels like youve lied or left her in the dark . this is especially important if this is a very close friend that you share everything with . if you start a relationship with this guy secretly , she will automatically be distrustful or resentful of it , and you could really hurt her feelings . when you have a crush on someone and the feeling is returned , it feels pretty awesome however , try to imagine or remember what its like when those feelings arent returned . recognize that your friend may feel really down in the dumps , and take care not to gloat or shove your happiness in her face . when you are with her , remember that its okay to talk about your crush , but dont let him be the only thing you talk about . if she is hurt the crush might be a sore topic . you need to decide this before going into the conversation . its entirely up to you to decide how to proceed in this situation . you can tell her that you really like this guy , you want to date him , but you wont go forward with it unless you have her blessing . alternatively , you can tell her that you plan on pursuing a relationship with him , and youd like her support . evaluate the consequences both good and bad of dating your crush before you decide what to do . think about how this might impact your relationship with your friend , and if you like this guy enough to risk straining , harming , or even ending your friendship . is this just a casual crush or someone you can see getting serious with think about your friends personality — does she have a hard time moving on from things is she the type who would see this as a betrayal , or be sad for a little while and then bounce backweigh the pros and cons of pursuing this relationship so you can go into the conversation with your friend with eyes wide open . if you tell your friend that you will not date him unless shes comfortable with it , you need to stick to that . keep in mind that if your friend disapproves of your relationship , it can cause a major strain on it . at the end of the day , it is your life . if you want to date your crush with or without your friends approval , you can however , you should be prepared for the consequences to your friendship . you can still be caring toward your friend even if you decide to date your crush without her approval . you could say , i really care about you and our friendship , and im excited about possibly dating john . i hope that you can eventually be happy for me . i will not let my dating life get in the way of our friendship . whether she is angry , upset , or jealous , she is still your friend . you do not have to change your plans based on her emotions , and you do not have to agree with everything she says , but you should be a kind person . remember , she is probably hurt that her crush has chosen you . be gentle , honest , and loving while she heals from rejection . this is particularly important if shes been a long - term , loyal friend . your crush may be really great , but your friend is too . its ok and human to want relationships with both , but take care not to neglect your friend for this guy . if youve told your friend how you feel , you might as well clue him in too . while sometimes a crush consists of flirting and subtle hints , it will make the situation easier on everyone if you know where your crush stands . for example , theres no need to do damage control on your friendship if you discover he likes someone else once both of your feelings are out in the open , you are able to decide how to proceed . in other words , dont betray your friend by blabbing to your crush about her . she may like him and she may be hurt — but that doesnt mean he needs to know that . talk to your crush about your own feelings , and let your friend keep hers private if she wishes . your friend will be hurt and embarrassed if she discovers youve been airing her dirty laundry to a boy she has feelings for . a good rule of thumb is to simply speak for yourself . talk only about your own feelings and desires , not anyone elses . if the feelings are mutual and you want to proceed with a relationship , take your time . let your friend adjust to the idea of you two being together before you change your facebook status and start bringing him as a date to everything . a slow and steady start can make for a healthy , solid relationship , too . that doesnt mean you need to lie to your friend and pretend that things arent happening with your crush . it just means letting her cope with the situation at a slower pace . if your crush doesnt respect or understand your need to take things slowly , he may not be the right guy for you after all . just because your friend has given her approval , that probably doesnt mean she wants to see you holding hands or kissing all the time . respect her enough to keep your pda and pet names to a minimum in her presence . if you want to call your boyfriend hot lips and sit on his lap in private , thats your prerogative . your friend doesnt need to see that though . on that note , your friends who never had a crush on him probably dont want to see that either , so keep the pda to a minimum . dont neglect your friend in order to spend all your time with this boy . a new relationship can be exciting , and its easy to want to spend all your time with your crush however , you need to show your friend that you value your friendship and arent going anywhere . if your friend tries to pull away because of hurt feelings , give her space but let her know that you cherish your friendship . you won the guy , so be loving and gracious with your friend . until shes solidly moved on , just bite your tongue when it comes to that kind of conversation . it will only seem like youre rubbing her face in your good fortune , and it could make her resentful . enjoy your relationship privately , and separate it from your friendship — at least for awhile .

practice , make sure you have good breath , flirt a little , time it right . ask , move your face slowly toward hers . try a simple close - mouthed kiss . tilt your head . move slowly and follow her lead . use your hands . be tender and loving . breathe . stop when youre ready . learn to french kiss . learn to make out . learn to kiss passionately . learn to kiss around other people . learn to kiss with braces .

how to kiss a girl for the first time

the best way to be more comfortable and better at kissing is to practice first . it seems like obvious advice but it really does help . you can practice on your hand , with another object , or with another person . keep in mind , you might not want to kiss another person because if you are already attached to girl you want to kiss or kiss her really soon after and she finds out , she might be upset . the girl doesnt want to taste garlic or other icky flavors after the kiss , as this can be a major turn off . before the date or when you see her , brush your teeth and tongue and use mouth wash to maintain good breath try drinking water on the date instead of soft drinks . you can also suck on a mint or chew minty gum for a few minutes mid - way through the date . if you are at a restaurant , bring along your favorite breath freshener . excuse yourself after dinner and go to the bathroom . freshen your breath and then , to make sure your breath smells good , hold your hand up to your face , breathe , and smell . this can help set the mood . tell her that what she is wearing looks pretty she will appreciate it if she playfully punches you a lot or teases you in a friendly manner , then she wants you to touch her . stay in safe territory like quickly grabbing her hand when you want to go show her something she will appreciate not having to do the whole awkward looking at each other and blushing thing . if you are brave you could put your arm around her waist when you two are laughing and say something playful like youre so cute offer to give her a piggyback ride , or tickle her a little if she likes it . dont do this constantly , and when you do it , do it respectfully . dont grab her breasts or butt . flirting will make her more open to kissing you . think of kissing as reaching the top of a mountain . you have to hike a little to get to the top . getting good timing will make it a lot easier . a good time for a kiss is at the end of a date , when youre generally saying goodbye , when youre out for a walk , or after youve just finished watching a movie . youll notice that all of these times are pretty private and should pretty much just be the two of you . this is important you should choose a private time for a first kiss . the kiss should stay private too . dont kiss and tell . this is rude . it seems weird because were only used to seeing the super charming people in movies kissing , but asking a girl if you can kiss her is a great way to show her that you respect her and care about her feelings . shell appreciate it you can say something like i really want to kiss you right now . is that okay or do you want me to kiss you now this is a universal signal that youre moving in for a kiss . this gives her the option to let you know that shes uncomfortable and will help keep you from getting slapped . dont close your eyes until you are just about to kiss her . dont use tongue the first time you kiss a girl . make sure you close your eyes right before you start the kiss . move in sideways a little . if your head is just as upright as her , youll bump your nose into her nose instead of your lips into her lips . if shes a deep , passionate kisser , shell hold your lips in hers for a long while you wont need to move your lips much . if you want , cup her face with your hand and slowly stroke her cheek with your thumb . make sure you still have one arm firm around her waist or lower back . kissing is like a silent conversation you want to be kind , gentle , forgiving , and you want the other person to keep coming back for more youd be surprised how many people forget to breathe when they arent used to kissing if you want to keep kissing her but youre having trouble finding a break to breathe , try moving away from kissing her mouth to kiss her cheek or forehead . slowly pull away after a few seconds or minutes and open your eyes . congratulations each kiss after the first one is so much easier . youve reached the top of the mountain . this is the next big skill for kissers to learn . its not as hard as it seems and , with practice , it can be a killer addition to you kissing arsenal . making out seems tough at first , especially if you both have trouble finding your rhythm , but it will get way easier with time . just make sure to not overdo it and always keep things interesting . once youve got those basic techniques in your repertoire , youll want to get really good at kissing , and that mostly comes down to being passionate . this is easy to do if you let yourself relax and let your feelings come out . chances are , the longer youre with your girl , the more likely it will be that you might find yourselves kissing around other people such as on a double or very public date . this is okay , but you want to be sure to do so politely if this is your first kiss , then theres a good chance you also have braces . dont worry despite all the jokes in movies and tv shows , its not all that tough to kiss with braces .

make yourself available . set up an accidental romantic situation . drop hints . be open . encourage her . let things happen . think about whether you really want to have a romantic relationship with the person you are interested in . be the best version of yourself you can be . respect her as a person with unique and independent thoughts . be a good friend . display your interest . look for signs that she is interested .

how to get a female friend to make the first move

it can be hard to catch a girls attention if she thinks you have other commitments . dont spend a lot of time hanging out with other girls in a one - on - one setting . consider mentioning that youre single around her , but dont force it into conversation or say it in a way that is self - pitying . mention how you wish you had something fun to do on a night youre free . your friend isnt going to make the move while youre out with your friends getting fast food . figure out something that the two of you can do together alone . dont do something dramatic like taking her to a fancy restaurant . something as simple as going to the park together is fine . let her know that you are interested . flirt with her a little bit . if you arent sure how to do this , just smiling and laughing a lot while you have a conversation is a good place to start . dont do it too much or it will seem forced , but doing it more than usual will let her know you are really enjoying talking to her . playing hard to get isnt going to work . be open and honest with her . give your honest opinion if she asks you what you think about something . you dont have to wear your heart on your sleeve , but you should be willing to talk about your feelings to a certain extent . if shes flirting with you , flirt back . gently tease her . mirror her body language the best you can to make her comfortable . shes never going to make a move if she doesnt think you want her to . ultimately , theres nothing that you can do that will force the girl to make the first move . you can only hope that she likes you and try to set up the right situation . if it seems like things are going well , relax and go with the flow . there will be a moment when its clear shes going to make a move where she slides close to you or makes eye contact for a long time while smiling . if youre already friends , it could change the dynamic of your relationship forever , even to the point that you no longer talk to one another . if you arent willing to take this risk , then it is best to move on and not pursue this relationship . it can be difficult to have feelings for someone and not show them , but they will eventually subside . if you cant pursue the relationship and are having trouble getting over her , try a new activity or go someplace youve never been before . it will help distract you from your friend , and you may even meet someone new you like while youre out . people say that you should be yourself when it comes to dating . this is true , but you should strive to be the best version of yourself you can be . make sure you practice good hygiene and wear clothes that fit well . keep your hair well - maintained . start exercising if you dont already , as muscularity is something that almost everyone sees as attractive . , just because she is single doesnt mean she is interested in dating , or interested in dating you . people are attracted to others for different reasons , and many times the feeling is not mutual . keep this in mind at all times so you dont disrespect her and do something immoral or unkind . dont get upset if shes interested in someone else . you probably could not have done anything to stop or change this . theres plenty of fish in the sea and youll find someone that makes you happy soon enough . above all , dont try to split them up . you shouldnt stop being a good friend because you have a romantic interest in them . in fact , being a good friend will help your case more than changing your how you interact with them would . it should be an authentic friendship that you maintain because you like them , not just because you want to hook up with them . if youre serious about this , you should also try to become friends with her group of friends . remember that these should be authentic friendships . people will quickly notice if you are just pretending to like them to get in their good graces . you dont have to be best friends , but you should at least try to be friendly . if you have already been friends with this person for a while , they may not know that you are romantically interested in them . try flirting a little bit by doing things like playfully teasing them while smiling and making eye contact . low - pressure physical contact like shoulder taps and touching their forearm is also appropriate , but remember to not take it too far . these things will let the person know you want to be more than just friends . if shes interested in you , shell do things to let you know it . she may start obviously flirting with you , but she may be a little subtler about it as well . look for signs like her smiling and tilting her head slightly upwards or her offering to share food off her plate with you . these are all signals that she is attracted to you . look for signs that she is not interested as well . if you see these , its time to stop , otherwise you are harassing your friend . she may not come out and say outright that she is not interested , but she may say something like im really happy with our friendship or turn away when you try flirting with her . if you suspect things arent going well , youre probably right .

assess your personalities . look at your habits . understand your abilities to compromise . assess your abilities to trust . understand the attraction . observe if she has the same feelings for you . take your time . spend some time together . use humor . be there for her . be patient . tell her how you feel . be prepared for rejection .

how to deal with falling in love with your best friend for guys

are they compatible youve likely seen your best friend in a relationship with someone else before . is she flirty with other men even when theyre not single or does she become all - consumed in a relationship with someone examine her and your own common traits when dating someone and see if you can handle this step - up in relation with her . does she do things which completely irritate you and vice versa if so , the chances of lasting in a long - term relationship will be affected . annoying habits are easy to brush over for a few months before they become all you notice . theres way more give - and - take in a relationship than there is in a friendship . can you truly accommodate each others wants and needs can you do so maturely if youre already best friends , you already knew each others secrets and some very personal information about one another . can you trust your friend not to fall in love with someone else again or use that information against you if you break up if the attraction is mostly physical , a fling may not be worth damaging such a close friendship over . if you dont want to risk the mental component of your relationship , look at finding a casual sex partner elsewhere . remember , she might look at you as a brother - figure and then be shocked when you tell her how you feel about her . this could ruin everything , but it could also make the relationship better . weigh the risks against the possibilities . be careful about coming out too suddenly or openly . no matter what you have to say , theres always a gentle way to say it . dont tell her right away . drop subtle comments like , you know , weve been friends for a long time , or what would i do without you these are essentially harmless displays of affection toward her . however , dont drop them too often because you will risk being too obvious . enjoy the same activities you always have as best friends . show her that youre fun to be around . if you both have a sense of humor , tell each other jokes you like . it serves to entertain you both and if youre lucky , you may get emotionally little closer before you even properly realize . if you have an inside joke , use it when it fits the situation . its important to understand what she needs . if she wants a shoulder to cry on , offer one . if shes cold , lend your jacket . over time , shes bound to notice how great you are . you need to make sure she sees what a great boyfriend you would make and starts thinking about the idea herself . remember to be there for her because you care about her , not because you expect anything in return . if youre lucky and compatible , things will work out . most relationships are made long in advance and are just waiting to happen . this is often easier for a guy than a girl because most girls are pretty considerate of feelings . give her a chance to understand you and when you think the time is right , tell her what you think . of course , you may risk ruining andor losing your friendship , or at least changing it even if you don´t want to . but if it turns out lucky , then she will be even more considerate of you and your feelings . if she doesnt end up liking you back , stay cool . be casual and try not to let the friendship get awkward . try to get things back to the way they were before .

consider the risks . look for hints . think compatibility . be sure of your motives . prepare for a rejection . plant the seed . deepen your interest . flirt . make her feel comfortable . ask for a date . arrange a first date . go slowly at first . get physical when the time is right . be open about the relationship . accept rejection gracefully . try to salvage the friendship .

how to date a friend

you are about to take a big risk . however close you may be , and however compatible you are as platonic friends , going from friend to boyfriend or girlfriend is a huge change in any relationship – so huge that it will be changed forever . you should therefore carefully consider whether the risk is worth it . can you get over a rejection are you willing to risk harming your friendship , even ending it , for the chance at love you , and your friend , might not want that . try to find out if the feeling is mutual . does your friend seem to drop verbal or physical hints that she sees you as a potential partner does she flirt with you or , does she treat you as a sibling or talk about her attraction to others if the latter , then she may be signalling that she isnt interested in you . you may be perfectly compatible as friends . you may get along famously , spending hours together one - on - one or in larger groups of friends , laughing together , and sharing all of your thoughts . but this does not guarantee you will be compatible as lovers . do you share the same values beliefs passions will you have good chemistry if you cannot determine this , can you honestly imagine that the two of you would work as a couple are you sure that your feelings are more than just lust or passing fancy sometimes major life events push people together and cloud our judgement . are you on the rebound are you lonely are you both dealing with personal loss , like a death in the family if the catalyst is one of these , you may want to wait and see how you feel in one or two months . make certain that your interest is motivated by legitimate desire , longing , or love . it may be that she doesnt see you as anything more than a friend . you have to be prepared for that possibility . you also have to understand that your relationship wont be quite the same once youve come clean with your feelings . it may be awkward , or it may end entirely . if you have decided to risk your friendship , you have to be able to accept the consequences . one way to begin your move is to signal that you are indeed interested . your friend may not realize it , and she may share your feelings and have no idea that you feel the same way . talk openly about your dating life . perhaps even ask your friend about hers . you will have to change the way that she sees you , and to show her that you are looking for a relationship . if you have known each other for a while , you should already have some idea of what your friend likes , dislikes , does for fun , and looks for in others . deepen your interest in her . ask her about her activities . does she like tennis didnt she know that you do too perhaps you could play a match together sometime focus on activities that you share with an eye to demonstrating your compatibility . scientific studies show that flirting – signalling interest and availability – often trumps physical attractiveness . start slowly . smile , make eye contact , joke , perhaps even lightly touch your friend on the arm . but dont come out too strong or too physically . after all , your aim is to signal your interest and at the same time put your friend at ease . even if you are flirting , always keep your friends level of comfort in mind . the worst possible thing you can do is to put her off by coming on too strongly . laughter is usually a good social lubricant make her laugh and show by your behavior and demeanor that you are a fun person , and that you enjoy her company . try to be your old lighthearted self - the one that she knows so well - and not let the pressures of the situation make you too serious . after you have weighed the decision , signaled your interest , and tested the waters , it is at last time to take the leap ask your friend out . keep in mind that you will have to be upfront about what you are asking so that there is no ambiguity . this is a date , not just a friendly get - together . the best way is to ask her in person . this will let you see her body language and reaction and help you to modify your behavior in turn . you may be more comfortable asking over the phone , by message , or through a third person , and these are all valid options . but keep in mind that face to face contact , however scary , is more personal and friendly . your friend said yes . what took you so long to ask in arranging the first date it is important to keep the situation low key . youve never been together in this way before , and both of you may feel stressed . go for a walk together , play a tennis match , go for coffee . it does not need to be a major event or even last long . the key thing is to see each other in a new dynamic . if the first date was a success , start to see each other more regularly . you will both need time to make a mental and physical transition from friends to couple . dont press the issue . on the other hand , make an effort to treat your new beau as a beau , not just your friend . start to plan proper dates and make it clear that the relationship has changed . there is no need to rush this . you may already be used to greeting each other with a hug . start there . after one or two dates , try holding her hand . be as confident and relaxed as possible , finding new but still comfortable ways to add touch to the relationship . in time , and with chemistry , you can start thinking about the first kiss and cuddling . you and your beau should be clear with each other about your expectations . if one of you wants a serious relationship and the other does not , things will probably not work out . let your friends in on your changed status , as well , especially if they are mutual friends . keeping them in the dark may make it seem as though you hiding something , or make for added complications . your friend may say no . she may feel that the first date didnt work or that you didnt share enough chemistry . or , you may date for a time before deciding that you were both better off as friends . whatever the case , you will have to come to terms with this outcome and move on in time . with luck you and your friend can still be on good terms , or even friends as in the past . a failed romance does not necessarily doom a friendship . but it can be problematic . if you decide to stay friends , try to stay lighthearted about your failed efforts - - a bit of humor can go along way . that said , set clear emotional and physical boundaries no kissing , no flirting , no hanky - panky . if you need time to mourn , put some distance between yourselves . date other people , as well . dont maintain the friendship in the sheer hope that shell somehow come around again and date you again . while the worst case scenario is having to cut off all contact , at the very least you will have closure and know that you gave it a valiant effort .

talk to his friends . start a club . find a new hobby . volunteer when you can . enjoy sports . burp when you want . go to happy hour . reassess your view of guys . understand that guys do see the potential for romance . avoid applying pressure . hide your true emotions . dont lose your self control . prepare for awkwardness . go out in groups . prepare for honesty . avoid affection . dont ask or give dating advice . avoid acting like his girlfriend if youre not . dont take advantage of his vulnerability . avoid comparison . never assume . read the signs . make sure you both know what you want . tell him how you feel . tell him if youre going to pursue someone else . be honest . prepare for the aftermath . be patient .

how to be close friends with the guy you like

boys can get lonely or alienated easily especially if their friends begin to mock them . by making friends with his friends you show that you are part of his network and can be trusted . learn about their dynamic and find out how you would fit into their circle . whether its a book club , microbrew club , or movie club , share an interest with him . invite others to join your club or keep it just the two of you . be careful not to make it seem like a date if youre just beginning your friendship . your club can meet once a week or once a month . you basically want to share an activity together to strengthen your friendship bond but you dont want him to feel suffocated . keep yourself occupied . you dont want your life to revolve around your friendship with him . plus , whether he shares your interest or not , a new hobby will give you something to talk about . take a class . study something that youve always been interested in so that you wont become bored . giving back to your community will give you a sense of well - being . its attractive to know that someone is selfless and looking to do some good . he may also want to participate or be inspired to find his own volunteer opportunities . its fairly obvious that boys enjoy watching and playing sports . you dont necessarily have to enjoy the same teams or sports as he does . enjoying your own team or sport would also be interesting to him . guys enjoy arguing over their favourite players or watching a game together . find something about the sport that you enjoy and focus on that . you dont need to know every detail but you do need to actually enjoy the sport . guys think that bodily noises are hilarious . it may be fun for you to see how far you can push your own gross boundaries . dont be self - conscious just follow the standards set by the rest of the boys . challenge him to a belching contest and crack the same type of jokes that his male friends do . the tired myth that girls dont have bodily functions , or cant be funny or gross or clever , is outdated and even harmful when it comes to relationships between men and women . show him that youre not a strange , weird being — youre a person , just like him , and you can be comfortable around each other and simply be yourselves . if you are of age , this is a good opportunity to get to know him in a social setting . invite your friends and tell him to invite his . its a cheap and fun social gathering that is a far cry from a date . dont assume that guys and girls cant be just friends . its easy to think about gender stereotypes but view him as an individual with his own ideals about friendship . you should be able to have different perspectives about things while still enjoying each others company . studies have shown that guys do think about having a romantic relationship with their female friends if they were given a chance . it may seem discouraging at first not to get the romantic attention but time may be on your side . a guy may not find a girl attractive at first but as time passes and he gets to know how smart , funny , and relatable she is , that girl becomes more attractive . studies show that both girls and boys get teased by peers to turn a platonic friendship into a romantic relationship . dont feel obligated to do something youre uncomfortable doing . be open with your friends and let them know that their teasing and pressure is hurtful . boys may get mocked more by their friends for having female friends who arent prospective girlfriends . friendship is not seen as masculine because it means that a boy must make himself vulnerable and confide in you . if he tells you about his latest crush or whats going on in his relationship , be supportive . you are a friend first and foremost . focus on your hope for a romantic relationship . the worst that can happen is that you have a really close friend who you can happy for . having desire is fine but acting on your emotions may lead to trouble . make sure you have a firm grasp of how he feels before you put yourself out there or you may lose a good friend . , a lot of tv shows and movies portray romance between friends as being an embarrassing mistake or an awkward situation . if you dont make the transition correctly , that very well might be the case . keep positive that your friendship will survive any fling . if there are romantic feelings , awkwardness will be inevitable unless one of you addresses how you feel about the other person . you dont want anyone to get the wrong idea . people may ask if youre a couple when they see you alone together . limit the time you spend alone in public together . try to include other people when you can . movies are fine but eating together may be questionable and get people talking . boys can be brutally honest so be prepared for blunt opinions and harsh comments . for example , if you ask a boy how you look you may not appreciate his true opinion . dont make this a one way street . if he is brutally honest with you , you may be brutally honest with him . put him at ease and let him know he can trust you like any of his male friends . dont give in to temptation and give him a hug or rest your head on his shoulder . if you get too touchy - feely you may give yourself away . dont blur the lines between boyfriend and friend . wait until youre ready and sure of yourself or you may make him defensive . boys dont talk about the details of their romantic lives the way girls do so dont expect him to open up . dont talk about your own romantic relationship because if he does have feelings for you he will become confused . keep the conversations platonic . if you tell him about your romantic life he may think that you only see him as a friend . if hes seeing someone you may automatically judge her and bad - mouth her . dont deny him a chance at romance . dont make him choose between her or you . avoid doting on him or flirting . let him know when hes being a jerk or acting inappropriately . compliment him when hes being a friend and scold him when hes not . if hes going through a crisis in his life like a breakup or death in the family , dont try to leverage his emotions into a romantic relationship . he will feel taken advantage of and angry . unlike girls , boys may be flattered to learn that a female friend likes them . girls may be upset and sad because trust has been lost . dont compare yourself to another girl that he likes or his current girlfriend . this will lead to a lot of anxiety and frustration . dont act like a jealous girlfriend when you are only friends . dont change who you are because you think that will win him over . you cant make him fall in love with you . save your dignity and be yourself . dont try to convince yourself of something that isnt there . he may tell you that he loves you but only as a friend . he may also say that he can see himself with you but only as a remote possibility and not at this second . save yourself from embarrassment . if he already has ambiguous relationships than he may want to have his cake and eat it too . be certain that he doesnt have another romantic interest or a serious girlfriend . has he introduced you to all his friends and stopped talking about other girls around you does he want to spend more alone time with you and plan out activities that resemble dates there are a number of signs that he may be giving off so pay attention . does he continually make it clear that hes single and often give scenarios where the two of you are dating his body language may change and he may be more touchy feely than usual . he may also start acting like your boyfriend or ask questions to probe about how youre feeling about him . what may seem obvious to you may seem vague and confusing to him . you need to have a crystal clear idea of your friendship and whether romance is the next logical step . its okay if you discover that this isnt a good idea . you dont want to lose a friendship by trying to force a relationship . if you dont want him to think of you as one of the boys or just a temporary fling , let him know how you feel . be direct and completely honest . open communication is key . be honest because any type of relationship that you want to preserve wont last if the truth is ever found out . being honest with yourself can also help you manage expectations . you cant protect his feelings or your own . letting him know that you have a romantic life might get him to clue about his feelings for you . dont be vague and dont allow him to be vague about any intimate encounters . you need to be truthful about your current sexual activities because if you move from friendship to something physical , you want to make sure that youre safe from any stds . laugh it off if he doesnt return your feelings . the longer you hold in your feelings , the harder it will be to continue being a true friend . you dont want to begin a friendship or a romance with a lie . if you plan to cross from friendship into something more , anticipate the possibilities . depending on the dynamics of your friendship , you may receive a variety of possible reactions . he may feel flattered , embarrassed , angry , or amused . if you put yourself out there and are initially rejected , let time take its course . if he is a true friend he will support you , listen to what you have to say , and will have your best interest in mind . he wont hurt you and if he does , youve dodged a bullet because he wasnt worth being your boyfriend or having you as a friend .

take a minute to appraise your own feelings . consider whether your friend feels the same way . talk to your other friends about it . spend some alone time together . keep your expectations in check . make sure the time is right . determine the best way to ask . ask in a friendly , relaxed way . remember that youre friends . try not to neglect your mutual friends . dont despair if it doesnt work out . enjoy each others company .

how to ask a friend on a date

how do you really feel about your friend perhaps youre just interested in getting to know them a little better , or maybe youve found that youre attracted to them and want to get to know them from a different perspective . feelings are often confusing things . make sure youve sorted out exactly how you feel and what you want before you try taking things to the next level . even if youre attracted to your friend , you may decide that its advisable to take things slowly and cautiously if the two of you are already close . think about the kind of vibes you get from your friend . are the two of you close , or do you just hang out with the same group of people do they laugh at your jokes and show an interest in what you have to say when youre talking try to gauge your friends feeling as accurately as you can . if its obvious that theres no real attraction being reciprocated , it might be best to hold off on asking them out . if they act warmly towards you , however , they may have similar feelings , and might have even hoped youd ask . if you have another friend that knows the friend in question and you feel comfortable talking to them about the situation , ask their thoughts on how you should proceed . they probably know something you dont one way or the other , or have unique insights into the matter that might not have occurred to you . your other friends will eventually find out if youre dating , so dont make it look like you were keeping it a secret from them . if your other friends learn how you feel , they may subtly talk to the friend you like , facilitating the process . keep in mind that your other friends are affected by whether or not you start dating . while this shouldnt necessarily prevent you from asking a friend out , show enough respect to be conscientious about your evolving relationship with that friend and what consequences it might have . the next time your group of friends is hanging out , look for opportunities to pair up or spend some time alone with the friend that you like . this could be playing a game of pool together , having a thoughtful one - on - one conversation at a party or standing next to each other at a concert . get comfortable with the idea of being alone with your friend and try to also get a sense of how they feel about it in these moments . if your friend gravitates to you during future hangouts , its probably a good sign . dont dole out your attention to your friends unfairly . take an opportunity to spend time alone with your friend if one arises , but dont make them feel forced to split off and ignore the rest of your company . dont expect too much to happen too soon , if at all . even if your friend likes you back , they may be reluctant to do anything that might jeopardize the relationship that the two of you currently have . whatever your friend decides , you should be okay with it . if you get too set on the idea of dating , it may come as a disappointment if your friend declines , which could create distance between the two of you as friends . learn to take no for an answer . if your friend agrees to spend time with you one - on - one but makes it known that theyre uneasy with the dating label , accept their position graciously and plan to find something casual to do . put whatever misgivings they have about endangering your friendship to rest by assuring them that youll remain friends regardless of how things turn out . you should be taking your friends feelings into consideration as well as your own . if theyve been giving you flirtatious signals , it might be a clue that theyre interested in you and will agree to a date . if they seem disinterested or youre having trouble reading their feelings , they may be uncomfortable with the idea . recognizing the appropriate point to ask a friend on a date will most often come down to personal judgment . its probably better not to ask your friend out in a group setting where they may feel pressure to respond in a certain way . the best way to ask someone on a date in most circumstances is face - to - face . however , since you and your friend already have an established platonic relationship , asking them out directly may be awkward or make them feel pressured . weigh your options . a friendly phone call might do it , or you could drop the proposition during a text conversation . your friend will probably be most amenable to the idea of going on a date if it doesnt feel like a big deal , so dont make it one . think about how your friend does most of their communicating and go with their preferred mode . that way nothing feels off when it comes time to broach the subject . once youve determined how youre going to ask , work the offer naturally into a conversation with your friend , or be collected and up - front about it . the two of you are already friends , so there should be a mutual degree of respect and comfort in place . frame the question in a way that reinforces that the decision is theirs , and that you want to remain friends either way . it might be easiest to suggest that just the two of you do something together as friends sometime , since this will cause no initial concern of changing the nature of the relationship . if your desire is to continue dating as more than friends , though , make sure youre displaying your intentions honestly . if your friend declines your offer , smile and carry on in an amiable manner . he or she will likely be worried about straining the friendship if they turn you down . make sure that they know youre still happy to be their friend . its possible that the time just wasnt right , but now that your friend is aware of your feelings they may in time discover that theyre attracted to you as well . no matter how things progress between you , your friendship is the foundation of your relationship and the most important thing . this thought should feel like a safety net for you when youre mustering the nerve to ask your friend out . if its not what your friend wants or theyre not yet open to the possibility , youll have your friendship to fall back on , and you should a true friend will understand and be there to make sure everything is okay . even if you start dating and things are going well , dont forget that they were your friend first . the comfort of that bond will make your connection even stronger . try to think of your new relationship as a branching outgrowth of your friendship , not a replacement for it . all of your interactions should come from a place of caring and acceptance . theres no reason for the friendship to suffer simply because youre trying to build on it . dating a friend can sometimes cause complications if you tend to hang around the same people . be upfront with your other friends about the situation and let them know that it wont alter the friendship of the group . take particular care not to isolate yourselves when youre with your mutual friends this can be easy to do when you first begin to date someone , but it might give the rest of your friends the impression that youre disinterested in them . since you began as friends , work on cultivating an environment where you can still spend time together even when youre involved with someone . make some time each week for all of your friends to get together . during this time , involve yourself in the groups activities and discussions , and dont make it feel like you and the friend you like are separating yourselves from the rest of your friends . if your dating efforts arent met with success , dont let it come between you and your friend . you knew to keep your expectations out of the picture , so theres no need to take it too hard . not wanting to date may just mean that he or she values you very highly as a friend , which is a good thing . theres no harm in liking someone , and you shouldnt feel awkward or guilty if you tried and things didnt work out . in the worst case scenario , you can simply go back to being friends . its a win - winyou shouldnt be embarrassed or feel the need to punish your friend if things dont work . withdrawing from your friend group will make you appear sulky and may send the message that you were only looking to date the person from the beginning . allowing resentment to build up will take its toll on your friendship , which is precisely what you dont want to happen . whether you hit it off on your date or you dont , take pleasure in being around one another . starting off as friends means you already know you have common interests , can communicate openly and like spending time together . look at it as a chance to spend some quality time with the person with no thought to the outcome . do things that you both enjoy and relish the occasion to make new experiences and memories with the friendship at the heart of your relationship . for a first date , keep things from feeling too serious by suggesting a short hike or picnic outside , a casual dinner at one of your favorite restaurants followed by coffee , or a movie .

look for obvious evidence of another woman . take note of changes to his physical appearance . notice if he is obsessed with his phone . watch out if hes always on social media . notice if hes constantly closing doors behind him . listen to warnings from your friends .

how to know if a guy is cheating on you 1

it may seem like a cliché , but finding a smear of lip gloss in a shade you dont wear on his shirt is a good sign that hes cheating . smelling another womans perfume on his hair or clothing is another warning sign . if you notice a lipstick stain or strange perfume on your boyfriend once , it may just be from a friend or relative , so you shouldnt necessarily worry . however , if it happens more than once , you may have cause for concern . when a guy starts seeing a new woman , he often starts to take more pride in his appearance , so he may starting working out more , using self - tanner , or whitening his teeth . if his grooming routine begins to change , it may mean that hes seeing someone else . a guy whos cheating may shower more often because hes trying to wash away another womans perfume , so if your boyfriend is suddenly showering two or more times a day , you may have reason to be concerned . most of us have our phones with us at all times , so theres nothing suspicious if thats the case with your boyfriend . however , if he never lets it out of his sight so he even takes it to the bathroom with him , that may be a sign that hes hiding something like another girl . even people who are in a relationship deserve privacy , so its never a good idea to go through your boyfriends phone to look at the call log , text messages , or emails . thats true even if you suspect that hes cheating . theres nothing wrong with having a facebook , twitter , instagram , andor other social media account . however , if your boyfriend is constantly scrolling through his twitter or instagram feed , it may be a sign that hes no longer committed to your relationship . if your boyfriend is a social media addict , he may be using the apps to communicate with other girls or even meet new people . just as with his phone , you should respect your boyfriends privacy even when youre suspicious . dont try to figure out his social media passwords , so you can go through his accounts . thats a classic sign that he has something to hide , particularly if he always used to leave them open before . he may be calling or texting another girl and trying to prevent you from finding out . even if your boyfriend isnt closing doors in order to communicate with other people , it can still be a sign of a problem in your relationship because it signifies emotional distance . if friends and family members that you trust start dropping hints that your boyfriend may be seeing someone on the side , you may want to evaluate your relationship and see if there may be truth to their suspicions . always consider the source when it comes to accusations that your boyfriend is cheating . some friends and family members may be genuinely concerned about you , but others may be letting their own baggage affect their perception . for example , if you have a friend whos recently had a significant other cheat on her , she may be more likely to accuse your guy , even if hes done nothing wrong .

take notice if hes prone to mood swings . pay attention if he stops saying i love you . its probably obvious , but if your boyfriend used to tell you how he felt all the time and now no longer communicates his feelings , it can be a significant warning sign . observe how affectionate he is with you . notice if hes more attentive than usual . pay attention to how often he picks fights . take note if hes suddenly suspicious of you .

how to know if a guy is cheating on you 2

if hes happy and upbeat when hes saying goodbye to you but quiet and withdrawn when youre together , it may be a sign that hes seeing another girl . balancing more than one relationship is difficult , so it may start to take its toll on your boyfriend . problems in one relationship can carry over to the other , so if your boyfriend is fighting with his other girlfriend , you may deal with the fallout in your relationship . thats because he may no longer have much emotion to invest in your relationship if hes putting all of his feelings into another relationship . see how he reacts when you say i love you . if hes reluctant to even say me too , thats a big red flag . if hes no longer as affectionate as he used to be , it can be a sign that hes seeing someone else and saving his affection for her . a noticeable decrease in kisses , hugs and other physical displays of affection can be a sign that hes cheating . all affection doesnt have to be physical . if he stops using his favorite nickname for you or doesnt use your special emojis in texts , you should also pay attention . sometimes , guilt can cause a guy to overcompensate so if hes cheating , he may try to make up for it by being overly nice . showering you with gifts , taking you to your favorite restaurant , or allowing you to choose what you watch on tv can all be signs that hes trying to ease a guilty conscience . guys are usually plagued by guilt and become overly affectionate in the early stages of cheating . as the relationship with the other woman continues , the guilt - - and the increased attention - - may diminish . he may try to start arguments with you , so he has an excuse to leave and go see another girl . if your boyfriend suddenly starts picking fights every time that youre together and you didnt use to fight that often , its probably a cause for concern . if your boyfriend starts accusing you of cheating even though theres no credible evidence , it may be a sign that hes seeing someone else . thats because he may be projecting his own behavior onto you - - he knows that hes cheating , so he assumes you must be too - - or he may simply be trying to deflect the guilt that he feels .

ask if somethings wrong . point out changes in his behavior . ask point blank . trust your gut .

how to know if a guy is cheating on you 3

you dont necessarily have to accuse your boyfriend of cheating , but tell him that you feel like something is off with him . being unable to communicate with your partner can cause significant problems in a relationship , so its best to just confront the issue directly . make sure to choose a time to talk with your boyfriend when you know you wont be interrupted . if you want to have a serious , honest conversation , neither of you should be taking phone calls or answering texts . try to stay as calm as possible . if you immediately put your boyfriend on the defensive , youre probably not going to get any real answers . remember that your goal is a conversation , not a confrontation . you dont want to come across as irrational or paranoid , so it helps to cite the specific evidence thats led you to suspect him , even if its just the fact that hes stopped calling you pet names or always takes his phone into the bathroom . for the best results , you should be as non - judgemental as possible when youre laying out the reasons that youve come to suspect your boyfriend of cheating , so try to start your sentences with i and not you . for example , you might say , i feel like were growing apart and im upset about it . that can make your boyfriend more likely to listen to what you have to say . if explaining the changes in your boyfriends behavior that concern you doesnt lead to the topic coming up , you may want to just ask him directly if hes cheating . youre probably going to be angry and upset , but dont resort to name calling or physical violence . the calmer you stay , the more likely you are to get a straight answer from your boyfriend . give you boyfriend a chance to answer your questions . dont yell at him or assume you know what hes going to say . he may have an explanation for his actions that will relieve your fears . unless you have ironclad proof that hes cheating , your boyfriend is most likely going to deny whatever accusations you level at him . in that situation , you have to listen to your instincts . if you really feel like you cant believe what hes telling you , then the trust is already broken in your relationship , and that can be difficult to bounce back from .

see if his looks have changed . pay attention to how he treats his body . pay attention to his body language .

how to find out if your boyfriend is cheating on you for girls 1

your mans appearance can say a lot about whether or not hes cheating . if he didnt care much about his appearance before , but now spends more time grooming than you do , then something is up . he may be improving or changing his looks to please his side piece . here are some signs that hes grooming for someone else if he used to be scruffy before , but hes always shaving . if he gets routine haircuts now , but let his hair grow shaggy before . if his clothes have improved significantly . if you catch him starting in the mirror to study his looks . if he always looks nice , even when hes supposed to be studying or working overtime . a big red flag is if he smells different . whether his body chemistry has changed slightly from being with another woman , or if he outright smells like perfume , this is a big sign that hes been spending time with someone else . if there are stray hairs on his body and clothes that do not belong to you . if your man suddenly cares a lot more about his body than he did before , then he may not be doing it just for you . unless hes suddenly determined to run a marathon , its more likely that hes improving his body for another lady . here are some signs if hes suddenly working out all the time and cares a great deal about his appearance . remember that going to the gym could also just be another excuse for seeing his lady . if hes dramatically changed his diet to be healthier . he could be doing this to impress someone else . if hes weirdly shy with his body around you and doesnt want you to see him with his shirt off , and only wants to have sex in the dark . this could mean that he feels hes being disloyal to his other woman . your mans body language can go a long way in telling you how he feels about you , and if hes really thinking about someone else instead of you . here are a few signs that he may be cheating on you if he doesnt make eye contact when you talk . if he used to be mr . eye contact , but now he always looks away or at the floor when you speak , then he may be doing it out of guilt . if he doesnt give you affection . if he used to shower you with affection but rarely touches you , this is a red flag . if he shows you affection in private , but not in public . though some guys are just shy about showing affection in public , if hes all over you when youre home , or even when youre home and hanging out with a few friends , but stands a foot away from you when youre at a restaurant , he may be worried that his other lady will spot you two together .

decide whether its worth it . ask yourself what you want . talk to your mutual friends . make sure your timing is right . spend more time with your friend . start small and work your way up . pursue someone else for a while . break the touch barrier . be upfront about your feelings . enjoy the comfort of dating a friend . be ready to live up to new expectations . indulge your common interests together . dont involve your friends in your problems . accept rejection gracefully . find support from your loved ones . take some time for yourself . focus on your friendship . dont blame yourself if the friendship ends .

how to escape the friend zone

attempting to transform your friendship into a dating relationship could have unintended repercussions . if things dont work out , the friendship might suffer or come to an end as a result . if you truly care about the person youve fallen for , think about whether youre willing to take that chance . it may be that you decide that youre better off as friends and adjust your expectations accordingly . think about your history with the other person and how they act towards you . do you detect any interest or affection how have things between the two of you progressed since you became friendsif the person you like tends to emphasize what a good friend you are , or compares you to a brother or sister , it may be their way of telling you that theyre satisfied with your established roles . analyze the nature of your desires . do you have real feelings for your friend , or is it simply a physical attraction its normal to be physically drawn to people of the opposite sex that you get along well with , and this can sometimes extend to your own friends . this doesnt necessarily mean , however , that the two of you would be able to fulfill each others needs in a dating relationship . be certain about what youre after before you make a move . an unsuccessful attempt at courting could mean the end of the friendship . hooking up does not necessarily mean leaving the friend zone . if anything , it could just make things more confusing for both of you . find out how the person youre interested in feels by talking to the friends you have in common . they can usually provide valuable insight into the mind state of your interest . theyll also be able to tell you whether trying to pursue a romantic relationship is a good idea , or whether youre putting your friendship in jeopardy . if your mutual friends think theres a chance of the two of you getting together , have them put in a good word on your behalf or drop subtle clues to your interest . hearing someone close to them say you guys look so cute together or you two would make the perfect couple might make all the difference in changing the way your friend sees you . while you should do whats right for you , its also worth considering how you and your friend becoming romantically involved could impact the rest of your friends . you may not feel as comfortable discussing the details of your relationship to someone who is also friends with your partner . a breakup could also leave your mutual friends conflicted over the best way to stay on good terms with both of you . even if you decide to take the direct approach , dont spill your guts out of the blue . wait until the two of you are alone and can talk openly without distraction or embarrassment . consider other situational details , as well—if your friend is going through a stressful time in their life or just got out of a longterm relationship , it may not be the right time to share your feelings with them . the best time to work your way out of the friend zone is when you and your interest get along well , spend a lot of time with each other and express your desires and frustrations about dating . youll already be armed with the resources and information you need to be able to meet their needs . offer to do things with your friend more often and change the nature of your time together . rather than interacting like casual friends the way you always have , show more of an interest in them , mentally and physically . getting out of the friend zone is often as simple as shifting the way your friend views you and your dynamic together . the more time you spend one - on - one , the more of your true feelings youll be able to show them . a good way to get more face time with the person youre interested in is to single them out . the next time youre hanging out with your friends , engage him or her in a private one - on - one conversation , or diverge from the group so that just the two of you can do some activity together . invite your friend to do things you know they enjoy , like attending a concert , going on a hike or playing a sport together . dont expect a lengthy friendship to turn into a passionate romance overnight . give the other person time to relax and update their perspective . go on a few casual non - dates at first , then ask for a more formal date when the time is right . let your gestures gradually become more flirty and playful , and escalate to more obvious affection later on . if you push too much right away , you might just end up scaring them off . it can be hard to find a good way to start flirting that isnt awkward . try paying the friend youre interested in genuine compliments from time to time , dropping hints about the things you like about their appearance and personality . eventually , theyll begin to see your comments in a new light . learn to interpret your friends behavior . if they respond well to lighthearted flirting , it could be a good sign . if they tend to shut down or change the subject when you show affection , they probably arent interested in you in that way . if there is someone else who you also like , then you might consider pursuing this person instead . doing this may give you a chance to process your feelings about a friend while also allowing you to have a romantic relationship . try to identify someone who is not a friend and who you think might be a good match for you . look for someone who shares your interests and someone to whom you are genuinely attracted . dont pretend to like someone else just to make your friend jealous . if you do start showing an interest in someone else , make sure that it is authentic . keep in mind that if your friend is interested in you , then your new relationship might cause them to act jealous . just make sure that this is not your goal in pursuing someone else . small , physical gestures are a building block of deeper intimacy . try being more hands - on with your interest . grab his arm suddenly while telling an exciting story , or place your hand on the small of her back when shes walking through the door ahead of you . this kind of subtle contact can awaken arousing feelings in your interest and may create a desire for more . increase physical contact with your friend slowly , and be respectful . not everyone likes being touched , and you may end up sending the wrong message if you act presumptuously or put your hands somewhere they shouldnt be . one of the major differences between friends and lovers is that lovers tend to touch each other in more flirtatious , suggestive ways . when you introduce a more intimate level of contact with your friend , it will naturally influence the way they view you and your relationship . whether youve grown tired of biding your time or youre just not one to beat around the bush , you may prefer to announce your feelings directly to your friend . this isnt always a bad idea . find a time when you can sit down with your friend one - on - one and talk things out . be heartfelt as you explain yourself , but try not to make them feel uncomfortable . let them know that you dont expect them to change the nature of your friendship , but that you had to get your feelings off your chest . getting it out in the open will put to rest any doubt in their mind , and give you a clear answer about whether or not theres a chance of being together as something more than friends . try saying something like , im nervous about telling you this but i feel . or weve spent so much time together and i like being around you . i have feelings for you and . your friend might be experiencing a similar dilemma but be hesitant to act on it because they dont sense that youre interested . if you can work up the nerve to be honest , you have a better chance of receiving a straightforward answer , which can save you from having to agonize about the situation for weeks and weeks . if your friend also has feelings for you , congrats youve successfully escaped the friend zone . the two of you can now begin moving your relationship forward . taking things to the next level with a friend can be a wonderfully rewarding experience because its a given that your personalities are compatible . youre already comfortable around your friend and know that theyll accept you for who you are , and this can make maintaining the relationship much easier . since you already know your partners character , habits and insecurities , you can skip the sometimes awkward first stages of getting to know each other and cut right to showering each other with love and affection . its okay to pace yourselves . dating a good friend might feel a little strange at first , so give yourself time to adjust as you grow closer . as great as dating one of your best friends can be , it also changes your dynamic . you need to be ready to respect the new boundaries and expectations that arise as your feelings develop . show your partner that you care for them as more than a friend , and that you take your new relationship roles seriously . make an effort to put them first rather than treating them like any other friend . you may feel quite comfortable with a close friend becoming your new boyfriend or girlfriend , but that doesnt mean that you shouldnt still treat them with the same consideration that you would in any other relationship . the behavior that you displayed toward each other as friends might need to be altered in order for your relationship to be successful . for example , your partner might expect you to text them when you wake up or before you go to bed . if youve historically been bad at texting , it may make you look insensitive once youve started dating . as a couple , you can keep doing the same kinds of things you used to do together as friends . go see bands you both like , hang out with mutual friends or agree on a favorite spot to meet for dinner . your history together as friends will have prepared you for a romance full of fun and excitement and allow you to connect on a much deeper level . youll be familiar with your partners likes and dislikes right off the bat . best of all , the two of you will never run out of things to talk about . one of the best things about transitioning from friendship to dating is that theres a guarantee that the two of you have lots of things in common . this takes the difficulty out of planning dates and thinking of ways to spend time together . communicate with one another openly and be able to positively resolve issues when they pop up . it can be tempting to vent to your other friends when you get upset , but this can complicate things and put them in an awkward position , as theyre so close to both of you . there needs to be a degree of privacy in your new relationship so you can keep your interactions with friends separate from your life as a couple . sharing too many details about your relationship with your friends could change the way they look at the other person , which is tricky if theyre also friends . fortunately , even arguing will be easier if youve started off as friends , as youll already know what sets the other person off and how to talk to them when theyre upset . be prepared to be turned down once you invite your friend to go on a date or make your feelings known . they may not feel the same way about you , and thats okay . smile and go back to acting in a way that you know theyre comfortable with to reassure them that you still want to be their friend . its not the end of the world , and youll feel better knowing once and for all that you gave it the shot it deserved . be able to take no for an answer . theres something to be said for determination , but when a guy or girl makes up their mind , you should be able to accept it . chances are , your friend will feel just as bad about turning you down as you do . keep your spirits high so that they wont worry about damaging your friendship . the better youre able to handle it , the more confident theyll feel in your desire to remain friends . soothe the discouragement of unrequited love by spending time with your friends and family . the more youre able to laugh and distract yourself , the better and more in control of your circumstance youll feel . it will serve as a reminder that you still have people who care about you , even when things dont go as you hoped . talking over your problems with someone close to you can often help put things in perspective . rejection can sting , and kind words dont always help . occasionally , its just easier to be alone . put your social obligations on hold for a while to reconnect with yourself and take inventory of the good things in your life . devote time to developing a skill or enjoying your hobbies . having the ability to comfort yourself in difficult times means that youll never have to worry about trying and failing . dont make it seem like youre pouting or trying to punish your friend for not feeling the same way . explain the time you take for yourself as a form of emotional healing and refinement . your nagging need to be in a relationship will disappear once youre able to find happiness in being alone . in the best case scenario , you share your feelings with the guy or girl youre interested in and they suggest that you work better as friends . consider this a stroke of good fortune . it may not be exactly what you wanted , but its a clear - cut answer and will let you know exactly where you stand and what aspects of your friendship to work on . think of it as an opportunity to get a fresh start in your relationship and become closer friends than ever . theres no guarantee that you friend wont change their mind in the future . let yourself be content with simply being friends for the time being , but dont feel like all is lost if youre sure of your feelings for them . your interest may not feel like they can remain friends with you after finding out how you truly feel about them . if this happens , understand that youve done nothing wrong . its important that you be honest with yourself and your friend , as ignoring your desires can cause the relationship to become frustrating for both of you . sometimes , however , things just may not work out in your favor . move on and take comfort in the fact that you gave it the chance it deserved . find productive ways of easing the pain , like writing out your thoughts in a journal or turning to your other friends for emotional support . if someone is willing to stop being your friend because theyve been put in a difficult position , chances are they didnt value your friendship that much to begin with .

ask if hes cheating . follow him . snoop through his things .

how to find out if your boyfriend is cheating on you for girls 2

once the signs have added up and you feel like youve already found out that hes cheating , its time to make him confess . the easiest way is just to have a conversation about it . then you can avoid snooping through his stuff , getting hurt when you see something you dont like , and spare yourself the extra pain and humiliation . heres how to do it catch him off guard . you should still pick the right time and place to do it , but you should ask him when hes not expecting it so hell be less likely to come up with a brilliant lie . tell him youd prefer honesty over more lies . make it sound like hes doing you a favor by confessing - - - which he really is doing . say , i think well both feel better once this is out in the open . make it sound like he would be very relieved to stop lying to you . he probably will . living a double life is exhausting . make eye contact . be really sincere . show him that hes really hurting you . if youre afraid to ask yourself but dont want to take the extreme route of following him or looking through his things , ask one of your friends , or even one of his friends who you really like . chances are , if his friend knows about his shady behavior , he may not feel good about it , either . if youre afraid to have a conversation or feel like you dont have enough evidence , follow him to see what hes really up to . you have to be sneaky about it or hell know , lose trust in you , and wont give you any evidence . heres what to do follow him in a friends car . if he says hes hanging out with the boys and you really want to see what hes doing , follow him in a friends car so he doesnt notice its you . pop in on him when hes not expecting it . come over at random times , like when he says hes cleaning for you or not feeling well . if hes not feeling well , bring over some soup and act like youre trying to be sweet . whether hes with another girl or not , see how he acts . is he happy to see you , or angry that you showed up without warning see if hes really working overtime . thats easy . just drop by his work to give him coffee or a late - night snack to see if hes there . or just drive by to see if his car is there . snooping through your mans things is the quickest way to break trust and put your relationship in jeopardy , but if youre really sure hes cheating and just want to put the nail in the coffin , then go for it . heres what you do look through his phone . if hes a good cheater , hell make it impossible for you to look through his phone , but try anyway . go through it when hes sleeping , or see if he drops it when hes getting out of the car and pick it up . check his computer . if hes dumb enough to leave his computer open , check out his email and his facebook messages . this will let you know if hes cheating pretty soon . also notice if he meticulously deletes all of his emails . thats a little fishy too . look through his stuff . if hes sleeping or not home , go through his desk , his bag , or even his wallet for any signs of affection from another lady . check his bank statements . do you not remember him spending 200 on you at a romantic italian place then he must have been shelling out cash for another lady .

see if theres a change in your sex life . see if hes much nicer or more helpful . see if hes meticulously clean all of a sudden . see if his mood changes . see if he engages in generally shady behavior .

how to find out if your boyfriend is cheating on you for girls 3

if he has another girlfriend , he may stop spending as much time in the bedroom with you , but it could also make him want to have more sex . here are some things to look if youre having a really long dry spell . if he never wants to have sex anymore , he may be getting it somewhere else . if he suddenly has a voracious sexual appetite . if he wants to have sex all the time all of a sudden , it may be because his sex drive has gone up from sleeping with another lady . if he tries a ton of new moves in bed . he could be picking these up from another girl . your boyfriend may have some serious guilt because hes cheating on you , and this will actually make him much nicer to you . if you find that suddenly hes helping out around the house a lot more or doing a ton of favors for you , he may be doing it to compensate . if he cleans your apartment , fixes your car , or buys your groceries and has never done those things before , there may be a reason for it . if hes always asking if theres any way he can help . if hes suddenly mr . romance and brings you candy and flowers , especially after a long period where he was distant . if your boyfriend never cared about the state of his car or apartment but now hes taking hours to clean it , he may be doing it to clean up for another lady or to hide evidence of her . if his car used to be messy and is now spotless , he may be keeping it fresh for another lady . if his apartment is much cleaner than it used to be , and if he always says he needs some time to clean up , he may be cleaning it to get rid of evidence of his other girl . if you really want to find out if hes cheating on you , come over when he says he is cleaning his apartment and see what hes really up to . if he uses air freshener in his car or home . he may be using it to hide the smell of his lead lady . whether he seems to always be in a good mood , or is just moody all the time instead of his usual even - keeled self , then something is up . pay attention to his mood to see if something is up if hes sometimes in a ridiculously good mood , like hes walking on sunshine , for no apparent reason . if hes grinning ear to ear and looking off into the distance like hes remembering a fond memory with another girl , then chances are his good mood has nothing to do with you . if hes suddenly in a terrible mood . if everything seems fine and hes suddenly furious or very upset , especially after a phone call or text message , then another girl may have had something to do with it . shady behavior is pretty easy to spot , and if hes doing at least a few shady things , then it can only add up to him sneaking around to spend time with another girl . here are some signs if hes spending a lot of time texting and on the phone . if he stops texting or ends his phone call as soon as you leave the room . if hes suddenly spending a lot of time online . this could be a sign that hes chatting it up with another girl . if he slams his computer shut when you walk into a room , that is a bad sign . if he disappears for hours , and is just incommunicado for a day , a night , or even a weekend . if he cant take the time to answer your call or just send you a quick message , then he may be with another girl . if he shuts his phone off for hours on end . why else would he do that

notice his excuses . notice the things he says .

how to find out if your boyfriend is cheating on you for girls 4

before , he always seemed ready to hang out , and now , his reasons for not being able to see you are piling up . at first , you believed him when he said he had a stomach ache or was too tired to go out , but youre starting to wonder if hes really trying to tell you that he doesnt want to spend time with you because hes busy hanging out with some other girl . here are some signs that he may be cheating if he used to save all of his free time for you , but now hes always going out for boys night . this is especially suspicious if he doesnt have that many male friends , or never showed much of an interest in hanging out with his bros before . if hes suddenly working overtime all the time . though hes worked overtime occasionally in the past , suddenly things are really busy at work , and he seems to always be there instead of hanging out with you . of course , many professions have a busy season , and he could be working on a more time - consuming project , but its more likely that hes using overtime to mean time with my other girlfriend . if hes always too tired to stay out late or hang out and was never tired before , this may be a sign that hes using his energy on someone else . if you made a routine of having lunch or dinner together often and now hes never in the mood , or just doesnt feel well or isnt hungry . none of these signs alone means that your boyfriend is cheating on you . but if all of these things come up repeatedly , then it either means that hes spending a lot of quality time with someone else , or that he doesnt want to spend time with you anymore . if hes always making excuses for why he doesnt want to hang out with you , then you should ask yourself why youre still in the relationship . even when hes not making excuses , your boyfriend could start saying things that make him sound like another person all together . if theres suddenly a change in how he talks to you and how he talks in general , then he may be thinking of another lady . here are some signs that the things he says may show that hes cheating if he stops complementing you . did he compliment you all the time before , and now he suddenly stopped any flattery if he never tells you youre beautiful , or mentions your best features and how awesome you generally are , then maybe hes saving all of his flattery for someone else . if he compliments you more often . if he wasnt a big complimenter , but suddenly hes always telling you how amazing you are , he may be doing it out of guilt . if he does this after a long and unexplained absence , then this is particularly suspicious . if he just sounds different . if hes saying things hes never said before , using words hes never used before , or even laughing in a new way , then maybe he picked up these words from a special lady . if he doesnt return your texts for hours in the middle of a conversation . if you were having a long texting exchange and hes suddenly mia , it may mean that his new lady just showed up .

exude confidence . remind your friend that he is your boyfriend , not theirs . stay friendly during the interaction . use hints in conversation .

how to deal with your friend who likes your boyfriend 1

your boyfriend chose to be with you for many reasons . dont let your philandering friend get in your head and make you forget that . showing you are confident in yourself may make them back off . it will also show your boyfriend that you know that you are a catch and that hes crazy if he lets your friend get between the two of you . tell yourself just how smart , kind , attractive , and funny you are if you ever get down on yourself because of this situation . laying on a few subtle , and not so subtle , hints to your friend reaffirms to them that he is yours . doing so may also make them feel guilty about their plans and help them decide to back off . for instance , if your friend asks if your boyfriend is joining when the two of you make plans , you could say in a joking manner , why am i not fun enough for you this lets the friend now that you are aware of their constant desire to be around your boyfriend . you could also make your friend know to back off by showing affection to your boyfriend , particularly if they are flirting with him right in front of you . you could smile at your friend and then plant a kiss on your mans cheek . this will definitely send the friend a message . walk up to the conversation with a smile on your face if your friend and boyfriend are having a talk . you could place your hand on your boyfriends back and say , what are we talking about acting in this way shows your boyfriend and friend that you expect to be a part of this conversation . you may want to be concerned if they stop talking or they move their bodies away from you . bring the attention towards your relationship if you find your friend and boyfriend having a talk . you can use subtle tricks to remind your friend that you and your boyfriend are a couple . for instance , remember to say we a lot when talking . instead of saying something like , i really like that restaurant , say we really like that restaurant . talking about what you do together can remind your friend that you and your boyfriend are united .

ask them if they like your boyfriend . tell them to back off . avoid putting yourself in the situation again .

how to deal with your friend who likes your boyfriend 2

sometimes the best way to get the information you want is to be blunt . being this way doesnt leave any wiggle room for misinterpretation and gets you a straight answer . for example , invite your friend out to coffee and say , im just wondering if you have feelings for my boyfriend . some of the things you do and ways you behave make me suspicious . your friend may get their feelings hurt , but its better to know . you will have to become more direct if they dont get the hint or they continue their behavior . your friendship is compromised anyways because of their flirting , so telling them to stop talking to your man wont do additional harm . for example , you can say , im not sure if youre trying to be funny or if you dont realize youre flirting , but its making me uncomfortable and i want you to stop . try to say this to them when you are alone . making a scene in front of people will only make the situation worse . stop bringing your friend around your boyfriend or end the relationship with them all together if the flirting doesnt stop . its clearly not a good friendship in the first place if your friend doesnt respect you or your relationship enough to back off .

ask if he suspects your friend likes him . look at him when hes around your friend . tell him you are not comfortable with the situation . understand your boyfriend may not be to blame .

how to deal with your friend who likes your boyfriend 3

its easy to think that others are after your man , even if youre not the jealous type . consulting with him gives you a second opinion , as yours could be a little skewed . you could say , do you think my friend has feelings for you i feel like i am seeing signs of it , but im not sure . what do you think take what he says to heart . however , look for signs that he may also be into your friend and is hiding it . these signs could include lots of eye contact , text messaging , finding excuses to be alone with your friend , and acting differently when around them . your man may give you subtle signs that hes picking up romantic vibes from your friend . pay attention to what he does when hes around them . you may see signals that he feels uncomfortable or is looking to you for help . for example , your boyfriend may look at you with widened eyes when your friend talks to him or acts inappropriately . he may also turn his body away from them and towards you when the suspected flirting occurs . are your boyfriend and friend texting each other do they share inside jokes do they often leave you out of the conversation if so , you have every right to speak up about it , if you dont like the way they behave . this is particularly so if you believe they may be having an affair . for instance , you could say , i love that you and my friend get along so well . however , im not comfortable with how you two act when youre around each other . it makes me concerned that something else may be going on . he will likely change his behavior if he truly cares about you and wants to make you feel more comfortable . it may be a sign that he enjoys the attention and likes your friend if he isnt willing to stop . try not to take your frustrations towards your friend out on your boyfriend . they are to blame , not him . getting mad at him may make him pull away from you and create the opposite result of what you want .

talk to a friend or close female family member about the situation . dont blame yourself . if youre in a situation where youll see them a lot work , school , extra things , etc . face the person and let them know that their behavior is wrong . decide if its sarcasm , teasing or abuse .

how to deal with boys who mistreat you

its their fault , not yours , and if its not your fault , try confronting them alone and see whats up with how they treat you , and if there is a way to solve this problem . but keep a friend close by if something goes wrong . , try to avoid those specific situations . if youre young , like in middle school , get a parent to talk to them . if youre an adult and you are in a relationship , you may want to consider breaking up . choose the right time to do it . if its teasing or sarcasm , just let him know you dont appreciate it and to stop . but if its really verbal abuse tell someone . it doesnt matter who , just tell someone .

dont answer to a nickname you dont like . ask friends to stop using a nickname . correct an introduction . deal with a bully calling you by a nickname . talk to an authority figure . sign off messages with your name . use your chosen name in conversation . introduce yourself at the start . remember that nicknames dont last forever .

how to get rid of a nickname

if someone has started calling you by a mean nickname , or something that you dont like , the first step is not to respond . he might be calling you by this nickname to try and get a rise from you , so try to ignore it , or just raise an eyebrow and walk on . if its your friends who are calling you by the nickname , they might not realise that you dont like it . calmly explain to them that it makes you feel bad , and youd like it if they would stop calling you by the nickname . good friends will understand and wont want to hurt your feelings . you could say guys , i know you think its funny to call me zack attack . but i really dont like that nickname . just call me zachary , my real name , okay there may be occasions when a friend introduces you to somebody by your nickname . this is a good opportunity to challenge the nickname and assert what you want to be called . if your friend introduces you by saying hi , this is my friend bobby . you can calmly just say , hi actually , its just bob . this will help ensure that the person you are meeting knows not to you use your nickname , while also showing your friend that you prefer to be called by your chosen name . if you are in any group situation and somebody uses your nickname , you can correct him like this . over time , people will stop using your nickname if you correct them . if the person calling you by a nickname is a bully , it will be harder to confront him . you should try to just ignore him , and not let him see that he has upset you or got to you . try to look confident and give off the impression that the name - calling is too stupid to think about . bullies want to take power away from you and make you scared . if you can demonstrate that its not working , they might lose interest . if bullies call you a name , you can show that youre not intimidated or scared by looking them in the eyes , laughing , and then just walking away without looking back . you could say something like here we go again . this is boring , or why are you talking to me you could say i dont know why you keep calling me that , but its boring and i dont care . dont get angry or upset . that could encourage a bully to just use your mean nickname more often . mean name - calling is bullying and you dont have to put up with it . if you have tried ignoring and then challenging the name - calling , but it continues to happen , talk to an authority figure . reporting the name - calling will alert your school to whats going on , and they can keep an eye on the situation . if its upsetting you , stick close to your friends for support . a good network of friends can be really helpful if you are being bullied . an important part of getting rid of a nickname , and making sure it doesnt come back , is reaffirming your chosen name . one of the ways you can do this is by signing off messages with this name . for example , make the effort to sign off an email or text with your name . just writing , ok , see you later . jill at the end of an email will get your friends more used to seeing this name . if you are leaving a voicemail message , use your name at the start . you could say hi , jan , its jill here . drop your chosen name into conversation to try and fix it in the minds of your friends . soon they will associate you with your chosen name and not the nickname . you have to be a little bit subtle with this , and avoid referring to yourself in the third person . for instance , when telling a story about what you did at the weekend dont say jill went shopping . you can drop your name into conversation by reporting a conversation , or what someone said to you . for example , you could say and then jan said to me , jill , what happened to the pizza , you can affirm your chosen name by being positive when you meet people or are in a group situation . if you show initiative , and introduce yourself before somebody else introduces you , you get to choose what name is used . get in there first to fix your chosen name in peoples minds . just introduce yourself casually by saying hey , everyone . im jill . if you having a hard time getting people to stop calling you by a nickname , you can take some comfort in remembering that nicknames dont last forever . as you get older people will use nicknames less and less . as you meet new people and have new experiences things like nicknames change too . if your friends continue to use a nickname you dont like even after you have explained how it upsets you , consider if they are really good friends . often people use nicknames as a sign of affection , and this changes as you get older and more mature . a nickname is only a name and does not represent who you are .

consider all the reasons why the crush is a bad idea . if your crush is inappropriate because youre already in a relationship , consider your background and whether your new crush could be undermining your relationships . if your crush is inappropriate because youre already in a casual relationship with no children who can be affected by leaving it , ask yourself about the current state of your relationship . project the potential fallout . consider your reputation . think about your future . focus on your crushs negative qualities . distract yourself as much as you can . avoid the person as much as you can . give it time . start dating other people when youre ready . if you cant fight it , find a way to make it right first .

how to stop having an inappropriate crush

instead of focusing on all of the reasons you are drawn to your crush , you need to change your focus and consider all of the reasons why the crush can lead to no good and is not worth pursuing . there are many different reasons why any crush can be inappropriate , and its important to know exactly what youd be getting yourself into in order to avoid it . you should think about why the crush is a bad idea , and consider potential reasons that you may be feeling what youre feeling other than the initial attraction , of course . here are some potential reasons you may be dealing with if heshes a lot younger than you are or heshes a lot older than you are , why are you interested in a young or old partner whose interests and priorities will be very different from your own if you are into a guy who works for you , are you more into the idea that you can call the shots than the actual person if you have a crush on your brothers girlfriend , is it more about getting one over on your brother than actual interest in the girl it might be that for a series of circumstances you are feeling needy and vulnerable , making it a bad time to take any action . if one or both parents had extra - marital affairs when you were growing up or if you have a history of infidelity you may have some underlying issues that need to be addressed to successfully enjoy a committed relationship . for example , if you have a crush on a guy but are already in a relationship , then you have to ask yourself if the crush is really meaningful , or if this is your way of telling yourself that its not really working out with you and your boyfriend . if you and your boyfriend were really happy together , then would you have room to develop strong feelings for another person of course , everyone , even the happiest couples , can get harmless little crushes from time to time , but if your crush turns more serious , then you should question your current relationship . this is your chance to exit without serious consequences if there is a problem . you should especially question the status of your current relationship if this kind of thing keeps happening . if you occasionally really click with someone outside of your relationship and feel a harmless crush on him or her while knowing it wont lead to anything , thats one thing , but if you feel frequently embroiled in a one - sided love affair , then you have to wonder about the real reason behind your feelings . if you were to get involved with this person , how would the fallout affect you herhim your friends , family , co - workers think as if it were a chess game and visualize the next several moves if i do this , then she will do that then my brother will hate me then the first time we argue i will lose my job . and so on . thinking about the worst that could happen if you and your crush were united can make you realize that it would be a huge mistake . ask yourself , is the potential relationship with this person worth all the trouble you will endure , and what are the chances the relationship would survive all of the chaos that will ensue what will other people think — will they think more , or less of you though we often say that it doesnt matter what people think and that love conquers all , in some cases , the fact of the matter is that what other people think does matter , because their disapproval , or even their scorn , may make it very difficult for you to carry out your potential inappropriate relationship . its important to step back and look at the big picture , to consider how other people would react to your relationship . if youre already certain its inappropriate , then considering how others would react will further dissuade you . here are some scenarios to consider its not cool to try to steal your buddys girl . you might end up with her , but you will lose your friend . if youre older , and the boy is a minor , you will be considered a cradle - robber —and on top of that , if you actually pursue that relationship into a sexual situation , you could be looking at jail . sex with a minor is worse than inappropriate — its a crime . sure , you may have a crush on your wifes sister . but imagine what would happen if you did anything about it — would your wife ever be able to look you in the eye would her family ever forgive you if you get involved with someone inappropriate , you will not just be dealing with problems now . you will be dealing with the fallout far — maybe years — into the future . its one thing to think about the exciting adventures youll have with your inappropriate crush if he or she returns you feelings , but its another try to imagine what your relationship will really look like in a few years . will it really be possible to sustain it will your feelings really last its important to think about whether you can really have a future with this person , or if you would just be sacrificing everything for a few fleeting moments of joy . for instance , the person you are crazy about may not be a very nice person . you start ditching your friends and family to spend time with her . shes super flaky , and you become flaky , too — going back on your word because she wasnt willing to do whatever it was you promised youd do — and wont let you do it , either . even after you break up with her , everyone you know will still view you with distrust . they will question your judgment for ever getting involved with someone like that in the first place . almost by definition , a crush involves an idealized picture of someone else . but everyone is human , and even your crush has characteristics that are probably not pleasant . perhaps he says mean things to people , or maybe she listens to music that you think is dumb . or perhaps he or she merely ignores you . try to work up some negative energy about the person that you can focus on in order to weaken the crush . write down a list of all of the negative qualities of your crush . if you really think your crush is perfect and you cant think of a single thing that is wrong with him or her , then this means that you dont know the person well enough . if you cant think of a single thing wrong with your crush , then you have him or her up on a pedestal . one of the reasons your crush may be inappropriate is simply because the person is bad for you . writing down the reasons why , such as the fact that the person abuses alcohol or is a known player , can help you see that , while you may get butterflies in your stomach when you see him , hes no good for you in the long run . now that youve analyzed , considered , and really meditated upon how terrible this idea is , you need to stop obsessing over this person . no matter how tempting it is to think about himher , fantasize , and get yourself all tingly doing it , stop it . think about and do something else . in loose psychological terms , its called redirecting behaviors and thought patterns . you have to find ways to stay busy and to stop thinking about your inappropriate crush . if all you do is sit around the house all day , then your inappropriate crush will be a lot harder to forget than if you throw yourself into your work and studies and have an active social life . at first , not thinking about your crush will be even harder because youll be so busy thinking about nothing thinking about him or her . but have faith — soon enough , youll be on your way to moving forward . learn to redirect your thoughts . train yourself to think about something else every time you start thinking about himher — think about how much you love the person youre with instead . think about how much work you have to get done . if youre at home , turn on the radio or tv , and get some other thoughts running through your head . if you still feel yourself reverting to thoughts of your forbidden crush , find someone to talk to call a friend . ask that friend if he or she wants to hang out — you can get out of the house and stop thinking about your crush throw yourself into a new hobby or an activity . try tennis , yoga , writing short stories , or training for a 5k . though these activities alone wont make you forget your crush , they will bring more richness to your life and will help you think of other things . if you can remove yourself from that person as much as possible , the crush will weaken . in order to sustain our adoration for someone , we generally need to reinforce it by seeing the person . absence usually doesnt make the heart grow fonder , actually . of course , this isnt always practical , but do what you can to minimize contact with the other person . try to avoid doing anything dramatic while finding a way to limit the time you spend with your crush . unfortunately , there are some cases where it would be quite hard to limit contact with the person entirely . if you have a crush on your married boss and it wont go away , for example , you may have to consider looking for another job . if you have a crush on your professor and it wont go away , see if you can switch into another class . if you do have to be in the same room as the person , try to minimize eye contact and conversation . you shouldnt make things extra awkward by avoiding or ignoring the person entirely , but you should limit how much time you spend interacting . all crushes fade with time . if you can avoid doing something regrettable and keep your feelings in check , eventually those powerful emotions will run their course . you may feel like youre trapped and that you are bound to have these feelings forever , but that wont be the case . one day , youll be looking back on this moment , wondering how you could have harbored such feelings . if you have faith that you wont always feel this way , youll be on the way to getting over it . unfortunately , theres no timeline for how long it takes to get over a crush . but if you go about living a busy and fulfilling life instead of spending all your time moping and pining , youll be guaranteed to get over it faster . if youre single , then you should begin to put yourself out there when youre starting to get over your crush . you dont have to feel 100 cured , but you should feel like youre ready to start a meaningful relationship with someone else — if youre still completely lovesick , then it wont be fair to the other person to start dating just to distract yourself . but once youre ready , ask a friend to set you up or be open to meeting new people . youll soon find that your crush is far from your thoughts . it doesnt matter if that person does not measure up to your wrong crush . what does matter is that you spend some time in the pleasant company of someone other than that person . start dating others , and keep an open mind . that person is off limits to you , and you have to start re - wiring your brain to think about being with someone else . lets face it sometimes , you cant convince yourself that you dont feel the way you feel . if youve tried to fight it , all to no avail , and you still find yourself sighing over himher , then make it right . there are ways to make an inappropriate crush totally appropriate — the most important thing to remember is to make it right first — and then , and only then —get involved . and then , true love wins the day if shes your brothers girl , then you have to behave as a gallant gentleman , and never hit on her . if your brother breaks up with her , you can ask your brother if hed mind you asking her out . maybe he wouldnt mind , and there certainly is precedent for it . if he doesnt break up with her , or if he wont give you permission , youre out of luck unless you are prepared to accept the consequences — your brother may not speak to you . if youre interested in someone much younger , wait for himher . dont get involved with anyone . bide your time , remain friendly , but dont get too close . love him or her from afar until it is appropriate . for example , if youre a high school senior and have been yearning for your early - twenties math teacher for years , wait until you graduate and get some more life experience before you decide whether or not you want to pursue the relationship . if you are falling for your subordinate , then you must decide what measures you should take at work before you pursue the relationship . you can transfer to another department or take on a different position , or do whatever you have to do at work so that your relationship would not be viewed as inappropriate or a power play .

call the authorities . look up the nearest marine animal rescue service . make sure its alive . keep people back . recruit others to help protect the dolphin . leave the dolphin where it is . understand the danger of illness . use extreme caution . stand away from the tail and face . continue to keep people back . check the location of the blowhole . roll the dolphin onto its belly if needed . douse the dolphin in water . get shade for the dolphin . dig holes under the pectoral fins . get out of the way of professionals . prepare for death .

how to save a stranded dolphin

the most important thing about a dolphin stranding is keeping everyone—people and dolphin—safe . the best way to do this is to report the dolphins presence to the local police . they will know what experts to contact to get proper care for the dolphin . the police may come to the scene to barricade the animal in order to prevent it from spreading disease . the dolphin may not have stranded itself because its sick , but if it is , the disease could pass to humans through contact . although the police will probably do this for you , its a good idea to report what you see directly . do an internet search for marine animal rescue service or regional stranding network with your location to find one . every coastal region of the united states has a volunteer stranding network . the national oceanic and atmospheric administration noaa connects with these networks to saved stranded mammals of all kinds , as well as turtles . make note of the dolphins physical characteristics so that the marine rescue agency you contact can bring the right equipment . even if the mammal is dead , the body needs to be removed from the beach to protect swimmers and other beach - goers . calling the authorities is the right thing to do whether its alive or dead . watch the blowhole . dolphins breathe out of this hole , not their mouths , so keep an eye on the blowhole for exhalation . you can do this without touching the dolphin . most dolphins can hold their breath for a long time , so wait about 20 minutes for breathing or movement . if there isnt any , the dolphin is probably dead . if the dolphin is dead , protocols like staying quiet do not apply , but staying back and not touching the dolphin become even more important in order to prevent the spread of disease . if you are the first responder to a stranded dolphin , its your job to coordinate the safety of both those near the dolphin and the dolphin itself . the most important thing for the safety of both is no contact . keep people , dogs , and anything else at least 50 feet away from the dolphin . ask them to keep quiet so the dolphin doesnt get upset . tell any crowd that has gathered what youre doing in a calm , low voice . explain that the dolphin is probably scared and to please keep their voices down . if you dont feel comfortable taking charge , quickly find someone who will step in . once people have moved away from the dolphin , recruit others to assist you . the more people are in the crowd , the more help you will need , especially if there are young children and pets present . trying to move a dolphin will make its current injuries worse , or injure it in a new way . the best thing for the dolphin is to let it lie still until professionals arrive with proper equipment . marine animals carry diseases . although scientists are not completely sure why dolphins strand themselves , one theory is that it is most likely due to disease . such diseases can easily pass to humans , so the best thing to do is not touch the dolphin . illness in wild animals is especially a concern for young children , whose immune systems are not as strong as those of adults . take special care that kids do not touch the dolphin . if you do come in contact with a dolphin , immediately wash your hands and skin . a stranded dolphin is a wild animal . it may feel threatened by your presence and choose to attack those near it . although dolphins usually defend themselves by swimming in packs of about 12 dolphins called pods , they can do some damage on their own with their strong beaks and tails . dolphins are strong , muscular creatures . make sure that if you are standing near , or working with , a stranded dolphin , be far from the face and tail . a dolphins most powerful feature is its tail . do not hold or even touch the tail . by shaking its head from side to side , a dolphin can strike anyone within range . make sure anyone who is authorized to help the dolphin stands clear of the face and the range of its snout . it may take some time for the authorities to arrive . while you wait , use your volunteers and keep the crowd at least 50 feet away from the dolphin . remember to have people keep their volume down so the dolphin is kept as calm as possible . explain to everyone that the dolphin can both hurt people standing too close and spread disease if touched . this explanation will more than likely keep people from ignoring you . if you do see someone touch the dolphin , make sure they wash their skin immediately . if the dolphin hurts someone , call 911 again to get an ambulance ready . a dolphins blowhole is located on the top of its head . any debris or blockage of this hole—even from water—can cause suffocation . never get water or sand anywhere near a dolphins blowhole . just like a human can drown if too much water comes into our mouths , dolphins can drown from water blocking their blowholes . if the dolphin is lying on its side or back , this means the blowhole is at risk of being blocked or is blocked entirely , whether by sand or water . since this will cause suffocation , there is an immediate need for someone to roll the dolphin onto its stomach . only proceed with this step if you have assistance and are confident you know what youre doingdo not pull on the fins or tail , or try to push the dolphin back into the water . soak towels in water and lay them over the dolphin . if someone has a bucket , they can pour water over the dolphins back , making sure not to get water near the blowhole . you can cover the dolphin with a wet towel below its blow hole if you cut a slit for the dorsal fin , which is the fin on the dolphins back . fit the towel very carefully over the dorsal fin . if the dolphin is in direct sunlight , create shade for it with a beach umbrella or other device , making sure it doesnt come in contact with the dolphin at any time . this will make the dolphin more comfortable as it is not used to being on land . the pectoral fins , also known as flippers , are not made for flat surfaces . you can also dig a hole under the chest and fill it with water . this will not only keep the dolphin wet , but it will support its chest while relieving pressure on the lungs and flippers . when the authorities arrive , get out of their way , and help the crowd stay out of the way too . the professional marine mammal rescuers that have arrived know how to take care of the dolphin better than you do , so making sure no one interferes is the best thing you can do for the dolphin . even with your best efforts , if a live stranded dolphin is already injured , dehydrated , or very sick , it may not survive its rescue . this may be especially difficult for children who are observing the rescue to cope with .

find a guided tour . visit an aquarium . go to the beach . support dolphin life . research the law . get into the water with dolphins and a qualified guide . do not approach the dolphin . watch for signs of distress . be careful not to hurt the dolphin . watch from a distance .

how to pet a dolphin

if you have the time and money this is perhaps the best option . in many warm weather locales there are guides who , for a fee , will take you to a local group of dolphins and help you interact with them . often such tours are led by scientific experts who can teach you or your children about our dolphin friends and their habitat . examples of such programs include discovery cove in orlando dolphin quest in hawaii dolphinaris in cancun dolphin cay in the bahamas and the dolphin research center in marathon , florida . if you did go on a guided dolphin tour , verify that it is legitimate and has a good safety record . sometimes you can pet dolphins without making a long hike to the ocean by visiting the local aquarium . the national aquarium offers special packages for those who want to get close to a dolphin under professional supervision . the same is true for some theme parks , like seaworld . dolphins can be found in oceans throughout the world . some places , however , are better than others for finding wild dolphins . the azores has the greatest variety of dolphin species and dolphins there frequently come close to shore . new zealand and the bahamas should also be on the top of the list for any tourist hoping to see dolphins in their natural habitat . while visiting a beach alone , keep your distance from dolphins . you can appreciate them from afar , but will put yourself at risk if you approach too close . while it might seem like more fun to swim with the dolphins , the best way to interact with a dolphin is to protect them from danger . some species of dolphin are endangered due to overfishing , global warming , and human encroachments on their habitat . through a conservationist group you can adopt a dolphin , get updates on dolphin issues or lobby government to protect endangered species . in some places , humans try to interact with dolphins so frequently that it disrupts their natural behavior . as a result , it is illegal to feed or approach a wild dolphin in many countries , including the united states . dolphins are large , powerful creates who can and occasionally do hurt humans . restrictions on human - dolphin interaction , therefore , are typically in the interest of both parties . if you are visiting dolphins in their natural habitat , get into the water no less than fifty feet from them . you should never attempt to approach a dolphin alone . better yet , do this with someone who is properly trained to interact with wild dolphins and knows how to read dolphin reactions . let the dolphin approach you . dolphins are easily scared and may get defensive and territorial . they will view you swimming up to them as aggressive behavior . while you might feel the urge to approach them , they are more likely to be friendly if they find you to be non - threatening . if the dolphins are smacking the water with their tail , leaping and spinning or exhaling loudly in quick bursts , they are probably agitated . back away and consider leaving the area . dolphins can be dangerous if aggravated . leave immediately if you see a mother with small babies . such an interaction can cause considerable distress . also pay attention to swimming patterns . if the dolphins are diving for an extended period of time or if they are making abrupt changes in the speed or direction of their swimming that are probably upset . when touching dolphins in captivity , be aware that they are sensitive . their skin is delicate and can easily be hurt by our fingernails . areas that are particularly sensitive include the blowhole , eyes , snout , lower jaw , and melon . petting a dolphin in the wild is not recommended . while watching a dolphin from a distance might be alright , any invasive activity might scare the dolphin away from its natural habitat . stay at least fifty feet away and leave within thirty minutes , unless you are in a controlled setting with a guide who says otherwise , you should keep your distance and watch the dolphins in their natural habitat . you should feel free to do this , either snorkeling or in a boat . as long as you do no see any of the aforementioned signs of agitation and do not stay in their space for more than thirty minutes , the interaction should be safe for all parties .

leave dolphins alone . make informed seafood purchases . boycott styrofoam products and non - biodegradable consumer goods . reduce your carbon footprint . fight global climate change . boycott marine theme parks that keep dolphins in captivity . get the word out and make it loud . encourage your congressional leader to strengthen the marine mammal protection act . donate to marine wildlife foundations . organize more significant boycotts in your area . start your own activist group . study marine biology . join a radical marine justice organization . take action against corporate polluters . attend rallies and stage your own protests . disrupt the fishing industry directly .

how to save dolphins

one of the easiest ways you can help to keep dolphins safe leave them be you should never attempt to feed dolphins , pet dolphins , or interrupt their way of life if you should see them in the ocean or in some freshwater rivers . avoid taking commercial cruise liners through endangered areas where youll likely encounter dolphin populations and coral reefs . its estimated that these ships destroy hundreds of yards of delicate coral every year , which provide habitat and shelter for dolphins and other marine life . even if youre a big fan of dolphins and would like to see them up close , sea - themed parks and aquatic swim - with - dolphins programs serve to keep dolphins in captivity , where they experience significantly shorter life spans . improper physical contact with dolphins can transfer diseases , making dolphins susceptible to fungal infections and a host of other problems . its much safer to leave them alone where they can live peacefully and happily . one of the most dangerous threats to dolphin populations is commercial fishing , and the nets the fishermen use . if you eat seafood , its important to make careful and intelligent seafood purchases . there are only so many fish in the sea , and many commercial fishing operations do more harm than good , while others harvest fish responsibly and sustainably . so how can you be sure you know where your salmon , tuna , or shrimp are coming from seafood watch publishes a free annual watch list , tracking the practices and the fishing statistics in the given you , allowing you to make up - to - date decisions and buy the safest seafood . the tuna fishing industry is the culprit most often blamed for dolphin deaths , and dolphin - safe tuna is a label you can often find at grocery stores . thats an easy way to make a simple change , but the problem is much larger than just tuna . make sure you stay informed and learn everything you can about the operation . human waste is the number one contributing factor to the degradation of life in the oceans , with 80 of marine pollution originating on land . the impact is enormous , and even something as simple as releasing a helium balloon into the sky can end up contributing the garbage that chokes the dolphin population out . take steps now to reduce your non - biodegradable garbage . it doesnt need to be complicated . take little steps by avoiding plastic coffee cups when you go to the coffee shop , bringing your own reusable thermos instead . avoid packaged food and products with excessive plastic packaging , choosing instead to purchase bulk groceries , or used goods . reuse plastic bags and avoid getting new ones at the store . the trash vortex is a patch of garbage that floats in the north pacific ocean , made up primarily of plastics , styrofoam , and other garbage carried by the current into a single place where it swirls constantly . its the size of texas and its full of dead ocean - life , birds , and other creatures that became ensnared in the waste . if you want to save dolphins , the impact of human waste on the ocean must be reduced immediately . its not just physical waste that interrupts the flow of life in the oceans . just as significant is air pollution , which resettles into fresh water and flows back into the oceans , making up about a third of contaminants in coastal areas . our use of fossil fuels is directly related to the health of the oceans , meaning that any steps you can take to reduce your carbon footprint from transportation will be directly linked to the safety of dolphins . start taking steps to drive less , switch to more fuel - efficient vehicles , or seek alternate methods of transportation , like walking , riding your bicycle , and sharing rides . there are somewhere in the neighborhood of 65 , 000 chemicals approved for use in commercial and industrial cleaners , as well as automotive products , and only about 300 of them have been tested for toxic properties . we have no idea about the impact seemingly safe products have on the environment . oil tanker spills get a lot of airplay , but sewage runoff sends twice as much oil into coastal waters every year . non - source point pollution is extremely difficult to control or trace , since it comes from the air , though we can be sure that most of it is directly related to commercial pollutants and industrial waste . as the temperatures of the ocean change , even by a few degrees , the whole delicate balance of the sea habitat will be thrown off , affecting the way dolphins and other sea creatures survive . as populations dwindle , itll become more and more difficult for dolphins to compete with other species for a reduced amount of food . if the temperatures dont stabilize , itll be very difficult for dolphins to survive . reduce your energy consumption , focus on reducing physical waste , and make more informed purchases with commercial cleaners , soaps , and other household products to reduce your own impact . avoid anything with parabens , phosphates , and styrofoam . aside from temperatures , oxygen depletion is a major problem associated with global climate change . nitrogen and phosphorus are elements found in fertilizer , commercial toxins , and sewage , which enter coastal waters and deplete the oxygen in the water . think of it as sucking the air out of a room the dolphins breathe in . a single gram of nitrogen or phosphorus can deplete between 10 and 100 grams of oxygen in seawater . while its fun to go see dolphins up close doing tricks , these parks separate baby dolphins from their mothers , keep them enclosed in tanks , feed them drugs , and force them to breed at exceptionally young ages . theyve also been accused of unsafe work environments for humans and dolphins alike , making parks like seaworld dangerous and unethical . dont support them . the biggest thing you can contribute to the cause of dolphins is your voice . if you care about keeping dolphins safe , shout it from the rooftops and learn everything you can about the dangers that face the dolphin population in your area . subscribe to dolphin watch organizations to keep up - to - date on current efforts and legislation that you could contribute to and encourage others to participate in . bluevoice is an ocean conservation organization that works to save dolphins and whales , specifically by tracking and fighting dolphin hunts in japan and peru . you can join bluevoice by signing up here . devote a considerable amount of your social media presence to dolphin causes and making others aware of whats going on in the oceans . the more people know what to avoid and are aware of the threat that dolphins face , the more changes can be made . in the 1970s , the government passed a bill designed to keep dolphins and other marine mammals safe , but it wasnt until the mid - 80s that stronger guidelines were put in place , specifically related to tuna fishing . the impact of these regulations made a huge difference then , in the short term , but little has been done in the decades since . its time to revisit the issue , so you should let your representative know you mean business . get in touch immediately . most communications happen online , so you can usually visit your senatorial or congressional representatives website to learn more about how to get in touch directly . draft a letter laying out a specific plan of action and demand results , or deny your vote during the next election cycle . changes specifically need to take into account the commercial and industrial pollutants and the way these contribute to the deaths of marine mammals . lots of organizations are already in place , fighting the good fight against pollution and ocean injustice . theyre often in dire financial straights , however , making any assistance you can offer extremely valuable . this is an especially great way to contribute if youre busy to participate directly , but feel passionately about the cause . organizations like the international fund for animal welfare ifaw , greenpeace , bluevoice , and other groups are all devoted to saving the lives of dolphins and they all would appreciate financial help to continue the cause . avoiding products and making smart purchases is a good step for you to take along–every single person makes a difference–but if you can rally the troops and make a more significant impact with larger numbers , your contribution will be much greater . try to work on changing your own household first , getting everyone you live with to contribute to the proper consumer choices , then start holding open meetings at a community center or church to share what you know and get others on board . getting in touch and spreading the word with letters to your local paper , sharing links on social media , and even making up posters can do a lot to share your message and let people know how they can make a difference . if youve got a growing group of like - minded people concerned about the plight of the dolphins , consider starting your own activist group to organize protests , boycotts , and stage information - disseminating meetings so that more and more people will become aware of the issues . the more people involved , the more the government will have to listen and make the changes necessary to take action . media is the strongest source of defense for fighting against the threats that harm dolphins . declare your organization with the irs and apply for non - profit status if you grow large enough to have significant operating costs and want to start collecting donations from visitors to the site . if you want to take the next step from dolphin - lover to professional defender of the dolphins , going into marine biology is the biggest likely career choice . this will not only allow you to be around the animals you love and hope to protect , but will allow you to study the ways in which the environment of dolphins is affected by the human footprint , and how to improve that environment . in school , work hard in biology and take as many natural science classes as you can . you wont start out by learning to scuba dive and swim with dolphins , but youll be building the necessary foundation to possibly do something like that for a living . when you get to college , there probably wont be a marine biology major , unless youre at certain coastal universities , but getting a general biology degree will allow you to specialize at the graduate level . take your education one step at a time . for some people , its not enough to donate some money and sit back to wait for changes passively . if youre frustrated with the slow process that justice usually takes , you might consider getting involved more directly with an activist group that works to disrupt the forces that endanger dolphins and other marine life . the sea shepherd conservation society the animal liberation front alf the taiji action group people for the ethical treatment of animals peta greenpeace many activist organizations , greenpeace especially , organize user - friendly activism and signature - gathering operations to disrupt corporate attempts to maintain the status - quo . these groups draw attention to the ways that corporations shirk their environmental responsibility to maximize profits and attempt to hold them to it . it usually benefits industry to work unregulated and unimpeded by things like carbon caps and environmental restrictions , which keeps the oceans polluted and dolphins in danger . work to change that . much of the dubious decision making happens at the legislative level , where corporate lobbyists work to change environmental legislation to indirectly benefit the entities that are destroying it . it can be awfully confusing for the layman , making your contributions to more professional organizations a lot easier than trying to go it alone . get your organization to post up outside of heavy polluters and try to get as much media coverage as you possibly can , spreading the word about how their pollution is affecting the dolphin population . greenpeace consistently organizes rallies and protests of major polluters , which you can subscribe to even if youre not a contributing member . be tenacious and be loud . you probably wont get an oil company to start cleaning up their act just by waving some signs around , but you can draw attention to whats happening , get on television , and make people start paying attention . throw the ball into their court . numbers are important , but even small protests register if the cause is important enough and if youve got controversy on your side . depending on the group you join , you might end up cutting fishing nets in international waters or riding around on anti - whaling ships to get in the face of illegal whalers like a pirate , or you might be mostly collecting signatures and combing through paperwork . how deep you dive into the dolphin - saving waters will be up to you , but direct action will ensure results . get involved and fight the good fight . while it may seem glamorous , hardcore radical activism can be dangerous and often illegal . if youre willing to get arrested to serve the cause , you need to do so as part of an organized effort , not by going rogue and getting yourself into trouble without any support .

give her space . ask yourself if shes actually ignoring you . consider that your girlfriend may be depressed . avoid the temptation to ignore her back . take care of yourself . set a date to speak in person . send an email or private message . use empathetic body language . express your thoughts and feelings using nonviolent communication . ask her about herself . ask her what she needs . be an active listener . come up with some possible solutions together . dont force a resolution . understand that one of the resolutions might be to break up .

how to deal with your girlfriend ignoring you

its possible that your girlfriend is mad at you , but its also possible that shes going through something tough that has nothing to do with you . either way , if you are getting negative feelings from her , dont push her to talk right away . give her some time to cool down . this will also give you time to think through your own feelings . has your girlfriends behaviour actually changed toward you is it possible that youre feeling depressed or anxious about something , and that youre imagining that her behaviour is worse than normal its possible that she has always been a bit cold toward you , but that as the relationship gets older , you are realizing that you dont like the way she behaves . have you been through anything difficult recently maybe youve been demanding more attention from her lately , and shes having a hard time meeting your needs , which has resulted in her pulling away . she may be ignoring you , but if shes struggling with depression , she might not even realize it . signs of depression include difficulties concentrating and making decisions fatigue feelings of helplessness , hopelessness , andor worthlessness insomnia or excessive sleeping irritability loss of interest in pleasurable activities such as sex or date nights overeating or loss of appetite anxiety suicidal thoughts andor destructive behaviour . if you think your girlfriend might be depressed , there are things that you can do to help . as tempting as it may be to ignore her back or try to make her jealous , its not healthy or productive to do so . in addition , if your girlfriend is depressed or struggling with some other difficult personal problem , ignoring her back will only make things harder for her , and could really damage your relationship . the elastic band theory suggests that you can make someone want you by pulling away from them . it may work for some people in the short term , but it is not the type of behaviour that you can build a healthy relationship on . one piece of positive advice that you can take from the elastic band theory is that people in relationships need space to do their own thing , otherwise they will tire of one another or begin to take one another for granted . you can take time for yourself and still be kind and respectful to your girlfriend . dont ignore her , but do make sure that you have a life outside of her . try not to dwell on how hurtupset your girlfriends behaviour is making you feel . remind yourself that she cant actually make you feel anything , and that you have a choice you can choose to acknowledge that youre upset , but to not let it hold you back from enjoying life . do things that make you feel good visit with friends , go to the gym , pick up hobbies for example , playing guitar , making movies , or hiking . if your girlfriend is completely ignoring you , you might not be able to get in touch with her via phone or in person . if you know she is still getting your texts , you might try sending her a message that expresses your concern and asks her to meet up and talk . example you havent been responding to my texts lately . when that happens , i feel hurt and wonder if youre still happy in our relationship . can we meet up and talk if you know her schedule , you might even suggest a day and time when she is usually free , which could make it easier to get her to commit to meeting up . skip this step if your girlfriend responds to you via text or phone . if you cant get in touch with her via text or phone , but you know that she is still okay i . e . hanging out with friends , posting to social media , you might try sending her a message that lays out your feelings and concerns via her facebook inbox or an email address . if you choose to send an emailprivate message , be sensitive to your tone . write a draft , then re - read it after youve had a good nights sleep . make sure that it isnt mean or disrespectful . be specific . provide concrete examples of what she does and how you feel . be sure to word it in a way that isnt accusatory when we were at that party on saturday , you spent the whole night talking to other people . we didnt get a chance to talk at all , and you left without saying goodbye , even though we were sitting across from each other in the same room . when you did that , i felt hurt . i wasnt sure if i had done something wrong . i am worried about you , and i am worried about us . i would like to get together in person and talk this through . or , if youre uncomfortable with that , i am also open to communicating via email for now . before sending your email , try to put yourself in her shoes as you give it a final read . think about how it might sound to her , and how she might react , and edit it to ensure that you are sharing your thoughts and feelings in the most effective way possible . if she understands your side and doesnt feel threatened , shes more likely to respond . if you manage to meet up with her in person to talk , use empathetic body language . this will show her that youre committed to understanding her side of the story , and it should encourage her to open up . empathetic body language includes facing the person in an open position i . e . not crossing your arms or hunching over or turning away , nodding and using eye contact to signal that you hear what shes saying , and making reassuring sounds to show understanding without interrupting . in nonviolent communication , you focus on your own thoughts and feelings rather than accusing the other person of doing something wrong . organize what you say in the following order observations , feelings , needs , and requests . example for the past week youve not answered my calls and youve cancelled our plans twice . im starting to worry that youre not interested in having a relationship with me any more . after youve expressed how you feel , let her know that you are open to communication , and encourage her to share her feelings . example for the past week youve not answered my calls and youve cancelled our plans twice . im starting to worry that youre not interested in having a relationship with me any more . i would like it if we could have a conversation about our relationship . if its not our relationship thats the problem , then i would like it if you could open up to me about what else is going on . if she admits that shes unhappy in some way , ask her what she needswhat you can do . she might need space , or maybe she wants you to do something youre not doing — it might even be something simple like hugging her more often or telling her shes beautiful . if she asks for space , dont panic . again , this could be completely about her and really have nothing to do with you . ask her if she knows how long she might need . if she says she doesnt know , suggest a time that feels okay to you — perhaps a week . be supportive . ask her if theres anything you can do — for example , call at the end of the week to check in . if you decide to give each other space , ensure that you are both clear on what that means . for some , space might just mean only talking on the phone twice a week instead of every night , or , it might mean an entire week without any communication whatsoever . clarifying what space means to you will help make that time easier . know that you dont have to give her what she says she needs . if you arent comfortable with something that she requests , its okay to tell her that . the two of you might be able to make a compromise . ultimately the two of you need to respect one anothers needs and boundaries . when its her turn to speak , actively listen to her . this involves empathetic body language open stance , nodding , reassuring sounds as well as showing your understanding by repeating what she has said andor asking for clarification . if you are hurt by something that she says , its okay to let her know that , but try to let her know in a non - confrontational way . example thank you for opening up to me . when you said that im too clingy , i felt sad and a bit confused . i enjoy spending time with you , but im also happy to do my own thing . i would like to know some of the specific things i do that lead you to think that im clingy . maybe ill be able to change some of those things . if she can give you some specific examples , even if you dont agree with them , it will help you get a better sense of what she wants from the relationship . knowing what she wants will give you a clearer idea of whether youre able or willing to give it to her . dont roll your eyes or interrupt her while she is talking . let her get it all out before you respond . what she has to say might be upsetting for you to hear you might not agree , but just let her get it all out before you respond . once youve worked out what some of the problems may be , work together to figure out how you can resolve them . if shes said that shes ignoring you because she feels overwhelmed by how much attention you pay to her , ask her to give you some specific examples of the things that you do that make her feel that way . perhaps she doesnt like that you call her three times a day at breakfast , lunch , and dinner . maybe you can agree to a good morning text and a short phone call after dinner every day . sometimes its better to take a break when emotions are heated , and to return to an argument later , especially if youve already been arguing for several hours . if you find that youre going in circles and solving nothing , its probably a good time to take a break . perhaps you cant meet up again for two days , and you would rather get it all sorted now . that desire is totally normal , but it really wont help either of you when youre both too exhausted from arguing to even think clearly . chances are , if youre worried about your girlfriend ignoring you , you want to keep the relationship . if its not a problem with your perception and its not something personal that shes struggling with , and if shes really just ignoring you because shes mad at you , you need to consider whether you want to be in a relationship with someone who would rather hurt you than tell you why theyre upset .

research whaling laws by reading government websites . brush up current laws . read reputable websites .

how to help stop whaling 1

university and government websites often contain information about animal protection laws . michigan state university provides an excellent website that discusses united states marine law . this includes information on special animal protection acts such as the marine mammal protection act and endangered species act . the national oceanic and atmospheric administration has a fantastic website containing a wealth of knowledge on maritime law . this organization works toward sustainable aquaculture . they are very active in research and reaching out to the community . the u . s . fish and wildlife services fws focuses on the protection of our environment . their website provides insights into us laws and customs that are specifically designed to protect animals . they provide clearly - written overviews of laws as well as helpful educational materials like handouts . some countries have already put a stop to whaling . in 1986 , the international whaling committee tried to conserve whaling species by passing specific laws and sanctions . even u . s . president obama passed sanctions on marine conservation in 2010 . know laws that are in progress . while certain laws have already been passed , you should be aware of what laws are in progress of being passed . you need to be aware of this situation so that you can better articulate your argument . this can help you focus how you might be able to help stop whaling . whaling is part of a world - wide conversation . in 2014 , the u . n . ordered japan to stop whaling near antarctica . as the whaling debate continues , more and more countries are taking action and passing laws to protect our marine mammals . , unfortunately , not all websites on the internet are created equally . while you are searching for facts , look at reputable websites that have fact - based information . these types of websites include non - profit organizations and government sites . they frequently end with the url . org or . gov .

take pictures of . dorsal fin saddle patch tail take notes in journal or sketchbook if you cant get a picture , sketch or note things like approximate size , behaviors , and markings , nicks , or scars on the dorsal fin or tail . use information for identification colors and markingsorcas have very bold black - and - white coloring . behaviors or unique markingsbesides having one blowhole , they are also known for coming out of the water in a certain way that is called breaching or spyhopping . look at orca types five known types exist depending upon geographical location resident dorsal fins more rounded at tip , larger pods transient dorsal fins more erect and elongated , smaller pods . caution , identify an orca there are several sites to help identify a specific whale using the information youve collected . report sightings bc cetacean sightings network httpwildwhales . orgsightings cascadia research httpwww . cascadiaresearch . orgreportingmarinemammalsighting . htm have fun and enjoy the experience

how to identify an orca

, their backs are black chests and lower jaw are white , along with a white patch positioned above and behind the eye . there are variable gray to white - colored saddle patches behind the dorsal fin . residents have a variety of saddle patch pigmentations and five different patterns have been noticed . transients have only two patterns that have been noticed . dorsal finresident whales have long dorsal fins that are curved at the tip . transient adult males are elongated and very straight at the tip . male dorsal fins can reach 6 feet 1 . 8 m and are more elongated than females . the dorsal fin on females can reach 3–4 feet 0 . 9–1 . 2 m long and are more curved than the males fin , similar to the juvenile orca . size know the size of your boat beforehand to compare with whale size males - the average length is 26–32 feet 7 . 9–9 . 8 m and can weigh nearly 22 , 000 lbs . females - the average length is up to 28 feet 8 . 5 m and they can weigh up to 16 , 500 lbs . tail orcas have lobes on their two - lobed tail that are called flukes . take note to the shape of the tail and if any unique patterns or marks are visible . heres a great site to help with tail identification . take notice to any scars or nicks you may see in their fins or unique markings . all of these things can help properly identify which whale it is . offshore dorsal fins slightly rounded but tip differs slightly from residents atlantic type a , b , c be careful not to confuse your orca with a false killer whale httpwww . nmfs . noaa . govprspeciesmammalscetaceanskillerwhale . htm please report your sightings to the below sources . some questions they may ask number of animals seen where did you see them latitude and longitude if possible when did you see them date and time of day what were they doing playing feeding , on what were there any males very large fin on their back any unusual markings scars have you see killer whales in this area during winter months in previous years did you get pictures of any killer whales ,

write letters . sign petitions . join organizations . adopt a whale . donate money . volunteer your time . boycott products from companies involved in whaling .

how to help stop whaling 2

get your message heard by writing to people of power . this includes your local government representatives . if you are us citizen , you can write to your state representative or even people in the national government . you may also contact organizations that are known for whaling . you can also write to organizations aimed at protecting whales to find out how you can help . your voice and signature can be a powerful tool to help pass laws . check whale - saving organizations to see if they have active petitions to save whales . singing a petition can help bring about the change of laws or the creation of new laws . if you are a us citizen , check out our national governments page of open petitions . , there are fantastic and reputable whale - saving organizations that are constantly looking for active members . organizations like world wildlife federation and pacific whale foundation are active supporters always looking for new participants . they have membership opportunities so that you may directly or indirectly join . , to become directly involved , you can adopt a whale through the world wildlife federation wwf . your donation will go directly to help organizations protect the species . , if you want to help indirectly , you can donate money directly to organizations designed to stop whaling . be careful and do your research before you give or send money . you want to make sure that you are not going to be scammed and your money is going to honest research . if you are geographically in a place to do so , consider volunteering your time . you can help spread the word through events . you can pass out information flyers . you can even lead your own event get involved with a cause you care about . boycotting is a great way to show companies that you are serious about your protest . by not purchasing products , you are halting supply and demand . this is a great way to protest as it hurts the companies main motivation - - its revenue . you can also boycott companies that do not take a stand against whaling . for example , in 2008 , a popular japanese camera company was boycotted because of its public stance on whaling .

tell your friends . join protests . start or join a conversation .

how to help stop whaling 3

if you feel strongly about this issue , a great way to help spread awareness is to get your loved ones involved . if your friends and family see how passionate you are about this topic , perhaps they will join you in your efforts . there are often marches or active protests against whaling . if you are in an area where you can do so , consider joining a march or picket to demonstrate what you have learned about whaling . go online or write about your concerns to a magazine or newspaper . the more you talk about this topic , the more your opinion will be heard . start a conversation about stopping whaling , and get more involved .

learn your capuchins body language . learn what your capuchins vocalizations mean . discover what upsets your capuchin . understand that your monkey may never behave . dont show fear . issue stern commands . give your monkey time out . do not hit your monkey . prepare for a commitment . provide plenty of attention . feed your capuchin a proper diet .

how to dominate a capuchin monkey

although capuchins do make some vocalizations , they communicate largely through their body language . learning their body language can be a great way to understand what your monkey is saying , allowing you to work with them to meet their needs . looking for signs of distress can help avoid any serious issues such as an attack or aggression . smiling is not a sign of happiness . monkeys smile or show their teeth when they are scared . jumping up and down or banging objects together can be a show of strength and intimidation . your monkey will likely have its own methods of expressing itself using body language . you will need to pay careful attention and learn what your monkey is trying to tell you . while body language is the main method that your capuchin will use to communicate , your monkey will also use vocalizations . learning what these vocalizations mean can help you to understand and work with your monkey to keep them happy and manage their behavior . loud screams can indicate a bad mood . a kind of purring is used when capuchins meet and are comfortable with each other . your monkey may seek to make contact with you if you are out of sight with a ik or fueh sound . if your monkey feels alarmed they may make an ik - a or i - tsch - g - k sound . a sharp whistling can also indicate your monkey feels threatened . your monkey may make sounds that are unique . you will need to pay careful attention to what your monkey might be trying to say when making noises . although capuchins are highly intelligent they lack impulse control and can also become upset or scared easily . learning the common causes of inappropriate behavior in your capuchin can help you and your monkey avoid these situations and improve your relationship . review some of the most common triggers for poor or dangerous behavior when working with a capuchin monkeysocial status . your monkey may feel insecure in their social standing or try to challenge your rank as alpha . territory . capuchins may claim items or spaces as their own and will defend them . fear . monkeys can easily become frightened by loud noises or fast movements . unfulfilled life . monkeys need a large amount of space and lots of social interaction to be happy . although you may offer your monkey a good home , excellent care , and training they may still never behave as you want them to . each monkey will have its own personality and it is impossible to predict or fully control the behavior of your monkey . you may need to build a permanent large shelter or cage for a monkey that is unsafe to be around . as monkeys age their behavior will also change . this is most obvious during puberty . while you can provide a great environment and care for your monkey , this is no guarantee that they will be safe to be around . if you monkey is acting aggressive or fearful you should not demonstrate any fear yourself . if you show fear to your monkey it may cause them to get even more aggressive and agitated . remain calm and resist any feelings of fear or discomfort that can result from your capuchins behavior . always move slowly and confidently . if bitten or scratched , try to remain calm . never react with quick or jerky movements even if your monkey is acting aggressively towards you . if your monkey is behaving in a way that is dangerous or unacceptable you must work quickly to let them know that you dont approve of that behavior . the best way to let your monkey know that you are in charge is to issue a stern command that they stop any aggressive behavior . issuing a simple command such as no or stop is enough . say your command quickly and clearly , speaking loudly without screaming the command . if you monkey is unable to calm down or is not responding to your verbal commands its time to put them in a time out . placing them in their cage will keep both of you safe and can also help send a message that their behavior was unacceptable . give your monkey a time out to manage poor or dangerous behavior . place your monkey back in their cage if they are misbehaving . a time out will allow your monkey time to calm down or escape whatever was making them nervous or aggressive . a cage for your monkey should be around 7x7x4 to provide plenty of space for them . hitting or violently handling your capuchin in an effort to get them to stop aggressive behavior will only destroy trust between you both . your monkey will come to view you as a threat instead of a friend and may still continue to act in a dangerous fashion regardless . use only verbal commands or temporary separation to train your monkey and maintain trust . other options such as surgically removing the finger tips or canine teeth will not calm your monkey down or build trust . hitting your monkey will only cause it to become more aggressive or fearful . shock collars , confinement in a small cage , or other restraint wont help with behavioral issues . with proper care and a good home your capuchin monkey can live for up to 45 years . during this time your monkey will require constant care and attention . while a capuchin monkey can be a great pet and companion you will need to be fully committed to caring for it over the course of its long life . many capuchin monkeys live for around thirty years . your monkey will require a great deal of care and attention . getting a capuchin monkey as a pet will be a long term commitment . capuchin monkeys are social and intelligent animals . in the wild they normally live with a group of other monkeys and enjoy a complex social life . you will need to provide as much social interaction as possible for your monkey in order to give them a happy and fulfilling life in your care . young monkeys will need almost constant contact with you . as monkeys age they will require less contact . however , you will still not be able to leave them alone for more than eight hours a day . it was once thought that pet monkeys needed to be given a simple pellet based diet . today it is understood that monkeys diets should be as varied and nutritious as our own . try to feed you monkey a balanced and nutritious diet to keep them happy and healthy . fruits such as mangos , pineapples , apples , pears , and grapes can be great parts of your monkeys diet . carrots , cucumbers , and sweet corn are examples of some vegetables you can include in your monkeys diet . boiled poultry and fish can be good sources of protein for your monkey . trying to recreate the natural act of food scavenging can be a good way to make your monkey feel at home and get some activity . hide some treats or put them in simple puzzles for your capuchin to solve .

contact the international whaling commission . speak out against seismic and sonar testing . sign a petition to stop whaling . organize a letter writing campaign . host a community event . support efforts to curb climate change . avoid products that contain whale meat .

how to help save whales 1

write a letter to your countrys representative on the international whaling commission iwc . visit the humane society international website . then click the link to tell your iwc representative that you care about the fate of the worlds whales . tell your iwc representative that you want the commission to close loopholes that allow japan , iceland , and norway to continue killing whales . sonar and seismic testing threaten whale populations in coastal areas . much of this testing is done by oil and gas companies or by federal agencies , like the united states navy . urge your government to stop sonar and seismic testing . try writing a letter to the national marine fisheries service and urge them to protect whales from seismic and sonar testing . one way to take direct action is by signing a petition to stop whaling in countries like japan , iceland , or norway . you can add your name to a growing list of global citizens who oppose the continuation of whaling practices . you can find global and local petitions on websites like change . org . one letter is powerful , but ten , twenty , or even a hundred letters can have a larger impact . get together a group of friends , family , colleagues , or classmates and ask them to all write letters to governments representatives on a particular issue concerning whales . try having a group of people work with the organization save the whales to send a flurry of letters to the norwegian embassy asking the norwegian government to stop supporting the whaling industry . it is important to inform others in your community about the threats faced by whale populations around the globe . consider organizing a community event where attendees can learn about threats to whales like japans black - market whale meat trade , the effects of climate change on whales , and government loopholes that allow whaling to continue . try screening a movie , hosting a dance party , or facilitating a round table community conversation about whales . consider taking donations at the event and giving them to an organization with an active anti - whaling campaign , like greenpeace . warming oceans and diminishing sea ice are affecting whale habitats around the globe . contact your government representatives and tell them to support international , national , and local efforts to curb carbon emissions and fight global warming . japan is free to ignore the statutes of the international whaling commission , and thereby sets its own quotas and standards for whaling . meat from japans so - called research whaling is then packaged and sold on international markets . avoid consuming whale meat or buying products made from whales .

note their natural environment . understand the lifespan of a capuchin . be clear on social behavior . observe sexual maturity . observe infant behavior . prepare to spend a lot of time with your capuchin . provide indoor and outdoor housing . be cautious with habitat openings . create a stimulating environment . change the environment . choose an indoor floor . clean your monkey enclosure . consider using diapers . secure acceptable areas . ensure the kitchen is completely off limits . remove all other pets . provide a commercial food . supplement feed with fruits and vegetables . provide occasional treats . give fresh water every day .

how to keep capuchin monkeys as pets

capuchin monkeys originate from the jungles of central and south america , where the climate tends to be warm . they live the majority of their lives in treetops , descending to the ground only for water . think about the environment you can provide , and how closely it mimics their natural environment . capuchins exhibit a 35 - 45 year lifespan in captivity . if you are adopting a capuchin as a baby , be sure you can commit to caring for the monkey for the entirety of his lifespan . your capuchin can outlive you , so enact a care plan if that should occur . capuchin monkeys live in social groups of 10 - 30 other capuchins . within each social group is one dominant male , who acts as the leader . social class exists within capuchin monkeys and affects everyday functioning of how the monkeys interact together . class structure influences if monkeys will race to defend another or leave him be . your capuchin may become aggressive toward you or begin throwing feces . this may be a way he is testing social boundaries with you . capuchin monkeys reach sexual maturity by age 4 or 5 . full grown capuchin monkeys weigh between 4 - 15 pounds , with larger males than females . female menstrual cycles occur every 14 to 20 days . with sexual maturity , behavior or personality changes may occur . adolescents that were docile and cuddly may become aggressive . mothers give birth to one baby , with a gestation of 160 days . the baby will cling to the mother for about three months , at which point he may start to explore the environment on his own . after about 3 months , babies will start to take solid food , and are typically weaned by about 1 year of age . if receiving a baby capuchin , do as much as you can to imitate the mothering . capuchin babies rely heavily on their mothers for the beginning of their lives , never leaving their side . let them cling to you and observe their surroundings while close to you . if the monkey seems scared or apprehensive , cuddle it . introduce objects and people slowly and show that you are ok with them . especially if you have an infant , you will need to spend much time with your monkey , serving as her caretaker . nothing can replace time and attention for your monkey , as capuchins are highly social . interact with your capuchin , provide cuddles , and play with toys . make all interactions highly enjoyable for your monkey . stop immediately and redirect to another activity if your monkey is unhappy . the bigger the enclosure , the better . it is best to provide an entire bedroom plus an outdoor section . the indoor section should be heated . you want your monkey to stay interested in the environment and not get bored . be sure to include some shade when building an outdoor section . monkeys are inherently curious . dont let monkey boredom lead to a missing monkey . be extra cautious to secure doors or any openings which your capuchin can use to escape . it is not overkill to create a double door structure . fill the habitat with items your monkey finds interesting . include items such as branches , trees and bushes , platforms , swings , ponds , tires , ladders , unbreakable mirrors , baby toys and dog toys . use non - toxic plants and trees such as bamboo , rubber tree , willow , palm or hibiscus . avoid american oak , cedar , mistletoe , and pencil trees as these can poison your monkey . to avoid boredom , change the layout of the enclosure . add new items or move items around . buy new toys or rotate toys as to keep your monkey always interested and playing . the floor should clean easily , such as a drop tray , peat , straw , or wood chips in smaller cages . larger cages can have cement or linoleum floors . monkeys are known to throw their food , rip things up , and even fling their feces . they are not clean animals . clean the monkey enclosure at least once each week . while they may look goofy , many monkey parents use diapers to eliminate large messes with bodily fluids . some monkeys will throw feces if they are annoyed , bored , or upset , so using diapers can reduce these messes . some monkey parents choose to use baby diapers with a hole cut for the tail , while others use rags or other at - home methods . be aware that older monkeys may start refusing to wear diapers or take them off and smear feces . there is no sure - fire way to eliminate messes . many monkey parents allow the monkeys to run around their house , but make sure the house is completely secure first . cover outlets and remove appliance cords . if your monkey contacts an electric current , it could kill your monkey . look around and determine whether your monkey can damage any of your belongings . if so , remove them . lock all doors that the monkey is not allowed to enter . while monkeys are often fascinated with lamps , they can be dangerous . remove any standing lamps that can fall over . monkeys like to place items on top of the bulbs , which can start a fire . your monkey is capable of unscrewing lightbulbs . your monkey can burn herself on the stove or injure herself with the knives . lots of accidents can occur in the kitchen , and its best to keep it off limits . you dont want a confrontation , so move any dogs , cats , birds , or other pets while your monkey plays . place them in a secured , locked room . specialized monkey food exists , which you can purchase from a specialty store or on - line . these foods provide proper nutrition to your monkey . both wet and dry food is available for purchase . use as directed . monkeys need to eat additional food outside of feed , such as fruits , nuts , and vegetables . add mangos , carrots , and sweet potatoes every day at night . all foods should be cut up so that it can fit into your monkeys hands . do not overfeed . monkeys will tend to throw food or create a mess when provided too much food . avoid feeding dairy , sweets , candies , or cereals as these are bad for capuchins . treats do not have to be given every day . consider a treat like raisins . do not feed in excess of 1 teaspoon . monkeys will need fresh water throughout the day . especially if your monkey splashes or creates a mess , you will need to refill the water several times each day .

research adoption to see what it entails . choose an organization for your adoption . choose an electronic adoption kit . choose a print format adoption kit .

how to adopt a dolphin 1

look up dolphin adoption to get a better idea of how your contribution can help . adoption is generally conducted through wildlife organizations who use the donations to conduct research and fund programs to protect animals . adoption usually includes updates about your dolphin , by mail or email . you can also adopt a dolphin as a gift for a friend or loved one . it is important to choose a reputable organization to go through to adopt a dolphin try researching wildlife organizations to get a sense of what some of the more well - established groups are . credible conservation groups and fundraising organizations will have a clear mission statement , state exactly how your contribution will be used , and offer proof that your contribution is tax deductible . be sure to avoid any websites that seems suspicious or have multiple pop - up windows these are not likely to belong to legitimate organizations . some trusted organizations offering dolphin adoption include the world wildlife fundthe pacific whale foundationthe oceanic societywhale and dolphin conservation wdcdolphin communication project , some organizations offer electronic kits when you adopt a dolphin , as opposed to print version kits . these packages may include material sent to you via email , video links , and photobook pdf downloads . you may also be provided with biographical information about your adopted dolphin in electronic format . updates on your dolphin may be available via online field reports or social media . most organizations offer print format adoption kits , which will be mailed to you . these packages may include an adoption certificate , a book or pamphlet with information about your dolphin , photographs of your dolphin , maps , or magazines . some organizations also offer plush toys , tote bags , bumper stickers , or collector cards with the adoption .

join a conservation organization . consider an ongoing monthly gift . adopt a whale .

how to help save whales 2

one of the most effective ways you can help save whales is by joining an organization that is actively working to stop practices that harm whales . you can become a member of a conservation organization with a small donation . students can usually join for a reduced fee . support an organization like the world wildlife fund or greenpeace , which are both working to help save whales . one of the most important ways you can help whale populations is with a continuing donation to a conservation organization . instead of making a one - time gift , consider setting up a monthly donation in a smaller amount . try making a monthly donation to a conservation organization like the natural resources defense council . some organizations allow individuals to make a symbolic whale adoption . for a donation to the organization , you can symbolically adopt a whale while donating cash to the cause . many organizations will give you a personalized adoption certificate commemorating your adoption . try adopting a whale through an organization like defenders of wildlife .

spot these dolphins virtually anywhere off the coast of the south island and off the west coast of the north island . identify the major characteristics of hectors dolphins . look for them in muddy , turbid waters such as can be found around estuaries . realize that these dolphins arent that acrobatic , they rarely leap out of the water , usually coming up to breath in a pretty calm , un - showy fashion . try spotting one near a boat .

how to identify a new zealand dolphin 1

blunt headed and only around 1 . 38m long , these guys stand out from other cetacea . they are patterned with black , pale grey and white . the dorsal fin is small and round and bellies outward , uniquely to this nz dolphin . males and females are the same in appearance to all intents and purposes . hectors dolphins are rarely seen more than 10km from shore . if youre in this kind of area and see a dolphin , you may have spotted a hectors . , they are often curious and will check out stationary boats to see whats going on on - board . the maori word for hectors dolphin is tupoupou .

research various establishments . look at dolphin adoption packages . sign up for an adoption package . visit your animal periodically to check in after adoption . read up on dolphins in captivity before adopting .

how to adopt a dolphin 2

you can run a google search on different zoos and aquariums - not necessarily in your city but anywhere in the world - to see which have a clean record and treat their animals with care and respect , as much as a zoo or aquarium environment allows . if you feel that the dolphins at a zoo or aquarium are not being cared for properly , look for other options or adopt from a recognized wildlife organization instead . if you live near a zoo or aquarium that offers dolphin adoption , you can also ask employees at the zoo or aquarium whether the dolphins are healthy the water condition is good the dolphins are being fed well the tanks are large enough to keep the dolphins happy and active many zoos and aquariums offer adoption of their animals as a way to offset the costs of food and veterinary bills . some packages may include an adoption certificate , photo , andor a plush toy . prices for these packages range widely and are generally tax - deductible . animals at zoos or aquariums might have more than one adoptive parent due to the popularity of the species . you can do this by visiting the zoo in person or by looking at the establishments website . usually , youll be asked to choose the dolphin you like the most out of several , select a package , and then make a payment . if you adopt a dolphin from a local zoo or aquarium , you have the bonus of being able to visit them in person whenever you want to check up on them . seeing the subject of your donation up close can be rewarding people tend to respond more to charitable causes that have one , clearly identifiable recipient . you can also introduce family and friends to your sponsored dolphin this way . there is ample research to suggest that being in captivity is detrimental for dolphins and other cetaceans . dolphins are highly intelligent , emotional creatures who live in complex societies in the wild , and travel and move regularlyin theory , no tank is big enough to accommodate dolphins , who swim up to 100 miles a day in the wild . keep in mind that when adopting a dolphin from a zoo or aquarium , you may be inadvertently supporting animal captivity . be comfortable with what your donation will be used for , be it research , education , or maintenance , and dont forget to check that the zoo or aquarium youre adopting from is legitimate , well - established , and treats its animals with as much dignity as possible .

understand that these are the dolphins you are most likely to see , look for their obvious beak . notice the size . look for their behaviour . spot these grey and white guys anywhere around the coast of new zealand munching on squid and small fish .

how to identify a new zealand dolphin 2

as you may have guessed from the name , they are one of the commonest dolphins in new zealand . if the upper surface of the flippers is dark with the sides of the flipper being distinctly yellowish or with a beige tinge , its a common dolphin . if you can get a sense of scale , a fully grown common dolphin is about 2 . 6m . these dolphins are active and playful , and they some times hang out with their cousins , the dusky dolphin . these are called aihe by maori .

easily distinguish a dusky dolphin by its short , stubby dark beak . look for their most striking feature , a flame shaped marking on its dusky flank . check for acrobatics and a lot of play .

how to identify a new zealand dolphin 3

these dolphins are smaller than the common dolphin . they only grow to 2m in length and have a two - tone dorsal fin . , these dolphins can be seen behaving boisterously , even for dolphins , all around new zealands coast except for the west coast of the north island . they can perform spectacular somersaults and body slams . in maori the dusky dolphin is called papahau .

look for a dolphin that resembles flipper . keep a look out all around in the waters around new zealand . know that this is the biggest species of nz dolphin with adults reaching 3 . 6m . check their colouring and features .

how to identify a new zealand dolphin 4

if you can spot flipper , you can spot a bottlenose dolphin the bottlenose dolphin may be spotted anywhere . , grey , primarily , bottlenose dolphins have a stubby beak and relatively long flippers . terehu is the maori word for bottlenose dolphin .

call for help . approach with care . apply zinc oxide - based sunscreen when possible . keep the animal cool . stay focused on helping the animal . wash your hands after touching a marine animal . this will minimize the spread of illnesses from the animal to you .

how to care for a beached animal 1

the national oceanic and atmospheric administration maintains a network of volunteers and professionals to respond in cases of stranding . alert local law enforcement as well . do your best to keep the crowds away . lifeguards might also be qualified to help a beached animal . bring the situation to the attention of nearby lifeguards , if any are present . contact the stranding network near you by searching the noaa database at httpwww . fisheries . noaa . govprhealthreport . htm . marine animals can be dangerous for many reasons . sharks and dolphins have sharp teeth which can easily hurt you . dolphins and whales may thrash about unpredictably while beached , and their powerful tails and snouts may cause injury . marine animals also carry diseases which can transfer to humans . for these reasons , you should always keep at least 150 feet away from beached animals unless specifically instructed to do otherwise by a trained professional . do not allow children or pets near beached marine animals . this can add undue stress to the animal . if a trained professional requests your aid , remove watches and jewelry which might damage the animals skin before approaching . slather the sunscreen across the skin of dolphins . be careful not to get any in the blowhole . zinc oxide can also be smeared around the blowhole of whales to keep it clear . since dolphins and whales are not usually exposed directly to the sun for long periods , they will need the protective coating that zinc oxide provides . do not apply suntan oil or other lotions to the animal . do not use zinc oxide on sharks . splash water over its skin and apply wet t - shirts or towels to it . do not cover the animals dorsal fin , pectoral flippers , or flukes . cut a slit in a wet t - shirt and ease the fin , fluke , or flipper through the slit so that the fabric rests on the animals body , not the fin . wrap ice packs in a cloth or t - shirt and apply them to the fins and tail . do not apply ice directly to the animals skin . use an umbrella or tarp to keep the animal in shade . do not get water in the blowhole . for instance , do not take pictures with a whale or dolphin . dolphins and whales dehydrate quickly when out of water and should be returned as soon as possible . spending time taking personal pictures or inviting others to pet the animal will minimize the time spent helping it , cause the animal to feel stressed , and put other people at risk . taking pictures of beached animals for scientific purposes is encouraged , but it should be done with care from a safe distance . pictures of a beached animals location , tags , lesions , wounds , and other signs of human interaction like entangled fishing nets should be photographed . take a shower if you leaned against the animal with your body or legs .

draw the body by drawing a really sloppy oval . add joints and head . finish the neck and add the ears . add muzzle and legs . add eyes and tail and finish the hind legs . using a pen , draw on top of your sketch . erase the pencil sketch and add details . color your wolf .

how to draw a wolf 1

draw a bean - shaped elongated oval for the body . make sure that you are using a pencil for the draft sketch so you can erase it afterwards to make it neat . draw a circle at the one end of the bean , this will be the head . for the hind joints , draw two overlapping circles . one should be smaller because its for the hind leg that is not in full view from the angle . at around the chest part of the wolf , add a slightly elongated circle for the fore legs . draw a two pointed curves on top of the head for the ears . unlike foxes , wolf ears are smaller . to work out the neck or the scruff just draw two slightly curved lines and connect both sides of the head to the bean - shaped body . for the hind legs , start by drawing curved lines from the leg joint . the lines should bend outwards towards the tail part of the wolf . for the fore legs , you can just add 2 thick lowercase l . since one of the wolfs legs is hidden , only a small part of the other leg could be seen . for the muzzle , add a small letter u at the head . for the eyes , just add two small tear - shaped figures above the muzzle . finish the hind leg by adding a similar shape to the one you did earlier but this time , add some small paws at the end of the legs . the tail is hardly seen because its hidden behind the hind legs . because of that , you can just add a long curvy line at the end of the bean - shaped body . you should have the basic drawing skeleton now . put in mind the overlapping lines and parts that should be hidden . remember to use fuzzy - looking crooked lines to get the wolfs furry look . the line art might not look perfect and crisp but it should look neat when the pencil is erased . you can add details like the ears , eyes , mouth , nose , paws , claws and fur . you can also add extra lines to emphasize the paw and the fur . depending on the breed , wolves can go in different shades from gray to brown or even white .

walk onto the platform , with food bucket in hand for positive reinforcement . walk to about 5 inches 12 . 7 cm from the edge of the platform , still directly in front of the dolphin , and kneel down . with the dolphin still at the station , place your right hand gently on the dolphins rostrum nose . with the hand that is on the dolphins rostrum , gently push towards dolphin , as if pushing the dolphins head away from you . gently grab onto its flukes and place into your lap , allowing the dolphin to relax and feel comfortable .

how to get a blood sample from a trained dolphin 1

you should point at the dolphin and point lead the dolphin to a station directly in front of you . maintain eye contact and stationing behavior of dolphin at all times . , at this point , the dolphin will lay backwards and present its flukes tail for you . if dolphin does not present its tail correctly , complete a least reinforcing stimulus lrs by waiting three seconds and ignoring the dolphin . then try the hand maneuvers again . if the dolphin layout is requested three times and not done properly , stop sample behavior and move on try the sample later in the day , or next day .

keep the animal upright . turn the animal upright . pour water over sharks .

how to care for a beached animal 2

blowholes on whales and dolphins should be pointing straight up and out of the surf . avoid getting water in the blowhole while rinsing the animal . dig a pit beneath the animals body and fill it with water to reduce pressure on the lungs . you should also dig water - filled pits beneath the animals tail and flippers . make sure fins and flipper are directed out and away from the animal in a natural way , not crushed beneath the body . if the animal is not upright , and you feel confident enough to move it , get the help of one or two other people to assist you in gently turning the animal upright . larger animals like whales might require four to six people to help turn it upright . use caution when rolling an animal . if the animal is too big , do not risk overexertion by trying to right it . sharks , unlike whales and dolphins , need water in their mouths and gills to breathe . pour a bucket of water slowly and steadily over the sharks gills , and carefully pour some over the sharks snout , allowing it to dribble into the sharks mouth . do not bring your hands too close to the sharks mouth , as a bite can be deadly .

identify problem animals . determine the possibility of returning a beached animal . once on land , and unsupported by the weightlessness of water , whales might crush their own internal organs and skeletons sperm whales and whales of even larger sizes are almost impossible to return to water . do not drag or push a beached animal back to water .

how to care for a beached animal 3

problem animals are those which were sick , confused , or injured , and may have led others to become stranded as well . returning problem animals that carry an illness could cause their podmates to become infected as well . wait for marine experts to decide what to do with problem animals . some beached animals are brought to zoos or aquariums while being nursed back to health . dolphins and sharks have a greater chance of being returned to water , but the decision should be made by a qualified marine expert . dragging the animal might cause it serious injury . instead , wait for expert help to arrive . chances are that a beached animal ended up beached because it was ill , and should be given medical care before returning it to the sea .

draw the body by drawing a really sloppy oval . add the 2 ovals . draw the muzzle and joints . add ear and legs . complete the legs . add paws . using a pen , draw on top of your sketch . erase the pencil sketch and add details . color your wolf .

how to draw a wolf 2

draw a bean - shaped elongated oval for the body . make sure that you are using a pencil for the draft sketch so you can erase it afterwards to make it neat . one oval should be bigger and longer and should point slanted upward . this is the wolfs neck and head . the other oval should be drawn on the other end of the body . a long , thinner , vertical oval will be added for the tail . just beside the tail and at the base of the slanted oval , add two circles for the leg joint . for the muzzle , add a smaller oval pointing in the same direction as the neckhead oval . add a tear - shaped figure below the muzzle this would be the jaw . because of the angle , only one ear is visible . and to draw this , just draw a small rounded triangle pointing the opposite direction as the muzzle . add the legs by drawing lines below the leg joints . the hind leg should bend towards the tail . add similar lines to define the width of the wolf legs . the bottom part of the legs should look flat into the ground . add another pair of legs behind the ones you drew before . because they are only slightly visible from the view , just draw a small part of them , peeking behind the legs add 2 pairs of circles at the end of the flat base of the legs . you should have the basic drawing skeleton now . put in mind the overlapping lines and parts that should be hidden . remember to use fuzzy - looking crooked lines to get the wolfs furry look . the line art might not look perfect and crisp but it should look neat when the pencil is erased . you can add details like the ears , eyes , mouth , nose , paws , claws and fur . you can also add extra lines to emphasize the paw and the fur . depending on the breed , wolves can go in different shades from gray to brown or even white .

draw a circle . draw a circle below the head and connect this to the head using curved lines for the body . draw three straight lines for the forelegs and a semi - circle for the feet . draw a half crescent shape for the tail pointing upwards . add details to the face . draw the head and make it look furry using small curved strokes . draw the rest of the body . erase unnecessary lines . color your drawing .

how to draw a wolf 3

add two protruding pointed shapes on each side at the top of the circle for the ears . using curved lines , draw the nose . , add another semi - circle for the hind legs foot . , draw an egg shape for the eyes , add a smaller circle within for the pupils . draw a curved line for the eyebrows and a circle at the tip of the nose . sketch three tiny circles at the side of the nose and draw a sharp fang using curved lines . , add a few curved strokes on the chest area for a furry look and sketch small slanted lines on the feet to separate the toes . ,

draw a circle for the head . draw a circular shape for the neck area and another one for the body . draw the limbs using curved and straight lines . add the tail on the rear part of the wolf using a curved line . add details to the face . draw the head using short slanted strokes for a furry look . draw the rest of the body adding a few slanted strokes for the fur . sketch soft slanted strokes on some parts of the wolfs body , especially on areas usually covered with shadow . erase unnecessary lines . color your drawing .

how to draw a wolf 4

add triangle like shapes on each side of the circle for the ears . draw a curved line in front of the circle for the protruded nose and sketch a crossed line from the circle extending to the nose . , draw two almond shapes with a circle inside for the eyes . draw the nose using a circular shape . sketch the mouth and draw sharp teeth . , sketch small slanted lines on each foot to separate the toes . ,

prepare . kneel down next to the trainer on the side that sample will be taken from . run a finger along the dark line in the fluke this is the main blood vessel . repeat swab procedure for a second time . get a needle with a capsule for the sample out from kit and insert the tip of the needle into the vein . draw the sample . rub the injection site with a new alcohol swab to clean the area . stand up and walk away from the trainer and dolphin , with the entire blood sample kit . finish up .

how to get a blood sample from a trained dolphin 2

you can begin the sample procedure once dolphin is in position and fully relaxed , no tense flukes . make sure that the entire blood sample kit is present with you . , once sample spot is found , rub three times , in a circular motion , with an alcohol swab . , once the needle is inserted , pull back the top of the needle plunger portion to draw blood inside of the capsule . once capsule is full , remove the needle and place the sample back into the kit . , after the procedure , tap twice with your hand on the dolphins fluke to signal the end of the sample taking and that the dolphin can return to its normal stationing position . if the procedure went well , reward the dolphin with reinforcement , i . e . food , toys , rub down , play , etc .

volunteer at a wolf sanctuary . volunteer in the wild . help an organisation with their work . attend an event or meeting .

how to take action to save wolves 1

a great way to help look after wolves , while raising awareness about the destruction of their natural environment , is to volunteer at a wolf sanctuary . search online to see if there is one near you . you are more likely to find a local sanctuary if you live in a state that has wild wolves . research the sanctuary and get in touch with them saying youd like to volunteer . volunteer roles can be competitive , so you will have to show why you are a good choice . volunteering schemes can vary from evenings and weekends to placements where you are on site for a few weeks , perhaps over a whole summer . volunteers in sanctuaries will generally do a wide - variety of things , such as cleaning out enclosures , feeding the animals , working in the gift shop , and conducting tours . if you would prefer to get out into the open country , there are a number of organisations that have volunteer programmes where you can do just that . search for wolf preservation volunteering online and look for programmes that involve hiking or cycling in the country . you may camp and be asked to take photos of the environment , while acting as a positive spokesperson for wolves . you should understand that you are very unlikely to actually come into contact with any wolves . you will most likely be tasked with maintaining the environment , assisting with daily jobs , and talking to visitors about wolves . this is a great way to experience the outdoors , meet new people , and help to save wolves all at the same time . another way to volunteer is to help an organisation with their office work , as well as their campaigning , fundraising and outreach work . search for the offices of wolf and wildlife charities that you could travel to , and contact them . explain what motivates you , and what skills and experience you have that can help . volunteers are vital for many charities , so dont be shy about getting in touch . volunteering like this can also be great way to develop all sorts of skills and experiences that help you develop . it might not seem as exciting as being in a sanctuary or out in the country , but a successful campaign needs people in the office . a great way to get involved in a movement to help protect wolves is to attend events and meetings that take place . there may be events locally that you can attend in order to hear people talking about the situation and what needs to be done . this is also a great way to meet people who know a lot about wolves and who can help you get more involved . this may involve going to local town hall meetings , or other such events , and speaking up about the plight of wolves . if your state has a lot of pressing issues to do with wolves , you may find debates and listening sessions about relevant legislation and regulation that you can attend . look on the websites of wolf charities for lists of upcoming events .

avoid areas where wolves have been seen . if the wolf sees you , back away slowly . dont run away . act aggressively and loudly if approached . fight back . stay alert . band together . keep a close eye on your dog . build a fire . create a defensive shelter . make a lot of noise .

how to survive a wolf attack

avoid being seen . if you see the wolf before it sees you , walk away silently . stay vigilant . remember where theres one wolf , there are likely more wolves around . wolves sometimes travel alone , but they almost always hunt in packs . always maintain eye contact , and do not turn your back . if you try to escape , keep the wolves in front of you . if the wolves get behind you , their predatory instincts may kick in . slowly back away while facing the pack . wolves are faster than you , especially when youre navigating the woods . furthermore , running will cause a wolfs prey drive to kick in . if the wolves werent chasing you before , theres a good chance that theyll start chasing you when you run . step towards the wolf , make noise , yell , and clap . back away slowly . keep acting aggressively , and keep making noise . maintain eye contact with the wolf , and do not turn your back . do not try to fight the wolves unless you have absolutely no other option . wolves are strong and smart , with powerful jaws and a killer instinct . theres a chance that youll be able to fend off a lone wolf , but you dont want to find yourself at odds with a group . breathe deeply and try to keep calm . wolves can sense your fear . if you panic , you risk freezing or running , thereby losing your ability to fight to save your life . if the wolf attacks , fend it off with sticks , rocks , bear spray , air horns , or any weapon that you have . find an easily - defensible position stand with your back against a tree or a large rock . you dont want the wolves to get behind you . do not try to hide in plain sight or curl up into a fetal position . this will not stop a wolf from killing you . in most cases , an attacking wolf will only leave if you intimidate it and present a bigger threat than it is willing to chance . if you do manage to drive off the wolf , get to safety calmly and quickly . climb a tree , a boulder , or another high landscape feature . if possible , get inside a nearby car or building . do not relax just yet . the wolf may be skulking near you or your campsite , awaiting another chance . if a wolf is particularly hungry , it may try to attack again . if you are in a group thats being attacked by wolves , make sure to keep all children and injured people in the center . when wolves attack herds of prey , they target the weakest link young , the old , and the sick . no matter what , do not break the group up . make sure that you have a person watching in every direction so that the wolves cant outflank your group . wolves aim to find the weakest link in prey groups . they are viewing you all as prey . children are the most likely to be targeted , as they are the smallest and the weakest . when wolves do attack humans , they attack children in an overwhelming majority of cases . this is how arctic wolves hunt musk oxen . they watch the herd from a distance , waiting for the flanks to open up when one of the adult oxen is distracted . they penetrate the interior of the herd to get to the weaker oxen within . if you are hiking with your dog in wolf territory , keep the dog in your sight . pick up its poop , keep it quiet , and try to keep it from peeing everywhere . all of these actions will attract wolves , and they will view you and your dog as intruders . both wolves and dogs use urine and droppings—along with scratches from their claws and scent rolling—to mark their territory , and wolves may attack a dog that they feel is encroaching on their territory . if wolves are prowling around your camp , light a smoky fire to keep them at bay . use green leaves and damp wood to make as much smoke as possible . when you have some smoking embers , move them near a tree , or disperse them between several trees . apply sap or resin to the branches , and light them . try to waft the smoke downwind toward the wolves . wolves dislike fire and smoke because it appears dangerous to them . if the wolves have pups around which is likely in spring , when wolf pups are born , then the fire may cause them to move to another den site if the breeding female believes that that safety of her pups is being threatened . use branches , stones , sharp sticks , and other solid objects to create a barrier around your site . if well - constructed , this may keep wolves from getting in – but dont forget that theyll still be able to smell you and hear you . wolves howl to claim their territory , and they may interpret the noise as you claiming your territory . if you are in a group , sing and shout together . be as loud and fierce as possible . avoid trying to imitate a wolf howl . this may draw the wolf to you . lone wolves howl to locate the other members of their pack , and wolves have been known to come running when humans imitate wolf howls .

research wolves a lot . visit people who have wolves or wolf - dogs and interview them about owning the animals . check your situation . ask yourself if you can manage the neighbors fear . expect wolves to be different to train and be less reliable than dogs . provide for safety of the public . find out whether you need a license or not to own wolves . know yourself . ask your family . visit a wolf shelter , if there is one near your house .

how to recognize the challenges of owning a wolf

this will provide you with enough information about wolves to feel like you actually are one . remember , you can never stop paying attention to them and catering to their needs . this can give you in - depth knowledge on wolves . do you have enough land for wolves they want several square miles where they can exercise an adequate enclosure for them , to prevent climbing or digging out an adequate source of food for them it will be more or less challenging depending on these factors . so , find out what a wolf needs and how to provide it . remember that you will need to protect livestock and wild game , and avoid possible complaints and lawsuits . as wolves are renowned hunters , aggressive , and may often howl at night , you should check with your neighbours if theyre okay with any ruckus the wolf may create before it has been trained . they may not socialize well or consistently , and may become bored with a routine and stop doing any trained response . they are less likely to respond well to scolding or voice commands , but more likely to follow positive firmness , desired rewards and hand commands . you need to be especially careful with any children who might enter your property they are more likely to be unaware of stranger - danger by wolves unfamiliarity with visitorsintruders , possibly seeing them as prey fresh food . some countries require licenses and in others it is impossible to own one legally as an individual . know your nations and states laws pertaining to wolves such as laws on dangerous animals , and be a responsible citizen . dont do anything without researching the law in your area , to avoid illegal activities . this may be obvious , but if you arent ready for a wolf or cant emotionally and physically control one being in charge of a strong , aggressive , tamed - wild animal , then dont get it . wolves need a lot of attention , exercise and companionship . can you provide that and withstand the constant demand on your time , as more than a once in a while interest realizing it is not a novelty for a month or a year , but a job for around fifteen years depending on answering yes or no , then your answer should be clear whether you can handle a wolf or not . ask them whether theyre willing to keep a wolf at home . after all , you cant do all the care - taking work interacting with wolves first hand can give you invaluable experience on how to take care of them .

know what a wolf hybrid is . investigate your local laws . consider the price . remember that wolves are not domesticated animals . talk to an expert . train the wolf . know that affection might be confused with aggression . build the proper living conditions . socialize the wolf dog . become the alpha . feed them the right food . provide entertainment for the wolves . make sure you have available veterinarian care .

how to own a pet wolf

a wolf hybrid , also called a wolf - dog , is an exotic animal that is a mixture of a domesticated dog and a wild wolf . most consider an animal a wolf hybrid if they have a pure wolf ancestor . this wolf should be at the most 5 generations back to be considered a wolf hybrid . however , consider why do you feel the need to own a wild animal in a domesticated setting . they are mostly considered companions instead of pets . low content lc hybrids only contain 1 - 49 wolf content . mid content mc hybrids contain 50 - 74 wolf content . high content hc hybrids are 75 wolf . hc hybrids are almost indistinguishable from a pure wolf . they may only contain 1 - 3 dog traits . while a lc hybrid wont act like a dog , they are better for someone new to wolf - dogs . they are more outgoing , easier to train , though they still have the wolf stubbornness and independence . wolf ownership is not legal everywhere . in the united states , the legality of owning a wolf varies from state the state . some states completely ban private ownership , some ban only certain exotic animals , others require a license , and others have no laws . look up your state , region , or countrys laws to make sure it is legal for you to own this type of animal . some states allow up to 98 wolf others draw the line at 75 , 25 , or no first generation crosses . wolves and wolf hybrids are not cheap . they average around 1500 and can go over 2000 . this is more expensive than most purebred dogs . decide if that is the kind of money you would like to spend on an animal . there is no way to prove the animals pedigree . experts at wolfdog rescue resources , inc . state that over half of the wolf hybrids being kept actually possess no wolf dna . other experts claim that the majority of wolf dog breeders are selling hybrids that actually are only dogs . when buying a wolf or wolf dog , make sure to get it checked out by an expert if at all possible . this can save you from dropping thousands of dollars on a fake . dogs have been bred to be submissive and to assist humans they have been bred to be pets . this process has taken 10 , 000 years . wolves , on the other hand , have spent the last 10 , 000 years being wild . though people keep wolves as pets when theyve raised them from a puppy , they are still instinctual animals that cant completely be tamed . do not take a wolf from the wild . if you are interested in owning a wolf , do not get one from the wild . instead , adopt one from a wolf sanctuary . taking wolves out of the wild can be very dangerous and might end in injury or even death . if you are still interested in owning a wolf or wolf hybrid , visit a wolf sanctuary . many sanctuaries have both wolves and wolf dogs that you can observe . before getting one of these exotic animals , talk to an expert at the sanctuary . they can help answer your questions , give you more information , and help you understand the responsibility that goes into owning a wolf or wolf dog . try finding wolf and wolf dog owners in your area . contact them and arrange a meeting . they can be a valuable source of information since they own an exotic animal . some of these sanctuaries rescue wolf hybrids and may let you adopt one from them . you cannot get away with buying a wolf or wolf hybrid and hoping it will figure out how to be a good pet . wolves are not dogs . they need a lot of training to become suitable as a companion , which takes a lot of time and effort on the owners part . these animals are cunning and extremely intelligent . they pose a much greater challenge than dogs . some wolf hybrids are docile , while others are essentially wild . if you dont have the patience or time to train and care for the wolf , dont get one . if you have never owned and trained a dog , do not attempt to get a wolf or wolf hybrid . many owners who arent prepared for their wolf or wolf dog end up either dropping them off at sanctuaries , which are already overcrowded , or taking them to the animal shelter where they will likely be put to sleep . letting them go into the wild almost guarantees they will die . adopting a wolf then getting rid of it does irreparable harm to the wolf . since they are pack animals , being split from their home and pack can cause the wolf to get extreme anxiety and even fall ill . wolves show affection differently than dogs . sometimes this affection can be confused with aggression . wolves greet each other with affection , but since they cant give hugs , they use their mouths . wolves will chew on pack - mates faces in greeting or as affection . wolves may do this to people , too . most of the time , the wolf will approach you , touch its nose to yours , and then lick your teeth . however , if you get scared and pull away , the wolf will grab your face with its teeth to bring you back so it can greet you and show its affection . wolves love small children , but they might get excited , jump on them , and try to carry them with their teeth by the head or arm . this could cause injury to the child when the wolf was only showing affection . these demonstrations of affection can easily be confused for attacks . wolves like to roam , and they will hop fences , break off chains , and dig their way out of yards . this can be very dangerous , because the wolf might be mistaken for a wild wolf or coyote and be shot . or it might kill neighbors livestock or pets . never let the wolf roam free . lc and some mc wolves can exist in a normal fence without breaking free . mc and hc wolves are most likely to try to break free . they need 6 - 8 feet fencing , along with other security measures . the fence cannot have any footholds for the wolf to climb because they can climb out of fenced in enclosures . you also need to dig - proof the area you will keep the animal in . some lc will break free while some hc will stay in the fence . it depends on how bad the animal wants to be free , how bored they are , and how much outside the fence excites them . a large fenced in enclosure is ideal . wolves and wolf dogs need a lot of room to run and play . wolves are social , pack animals , so they require canine companionship . just as important is socializing your wolf or wolf dog to people and places at a very young age . this starts training the wolf or wolf dog to be around people in a domesticated setting . the wolf dog needs to be taken from its mother at 2 weeks old and bottle fed . they need to immediately start being socialized to both male and female humans so they will be used to humans for the rest of their life . wolves need another canine for companionship and to meet their emotional needs . you need to place the wolves with another canine of the opposite sex around the same size . this ensures the wolf or wolf dog will not be lonely . you have to be the alpha of your wolf . when the animal is a puppy , start training them to submit on cue . this doesnt mean that the adult will always submit - wolves are very independent and self - assured . but the wolf or wolf dog will know you are the alpha and the one in charge . while training the pup , never hit , bite , shout , or pin or shake the puppy by the scruff . wolf parents dont punish their pups for chewing and biting they are very tolerant parents . try to refrain from physically dominating the wolf , because this could damage the relationship . wolves exist on a meat diet . pure wolves and hc hybrids wont be able to exist on dry dog food . most wolves and wolf hybrids eat 2 - 5 pounds of meat daily . venison is great for wolves . you can feed them fresh road - kill deer , but this requires a permit . wolves can get very bored , which could result in them breaking free from their enclosure to find stimulation . build things inside their enclosure area to keep them active , like platforms . wolves need to be mentally stimulated on a regular basis . make sure there are trees around and use old logs to hide treats inside . another good idea is providing swimming areas , like water troughs , swimming pools , creeks , or ponds , for them to lay in and to dig inside . sandboxes or dirt piles are great for them to dig in . leash train them as pups so you can take them out on a leash . you should use two leashes when you walk them - one on the collar or harness , the other a slip leash . you should walk them every day . most vets dont know how to care for wolves or wolf dogs . many will even refuse to provide treatment on these types of canines . make sure to find a vet who will care for your wolf before you purchase one .

talk to friends and family . sign online petitions . use social media to raise awareness . contact your political representatives . contact overseas politicians .

how to take action to save wolves 2

you can become an advocate for the protection of wolves simply by talking to people you know and convincing them that action needs to be taken to help save wolves . if you convince people you know to sign a petition , contact their political representatives , make a donation to a wildlife protection charity , or volunteer their time to help wolves , you have single - handedly made a difference . if you dont have much spare money or time , just raising awareness amongst people you know and meet is a good way to take action . be sure you know the facts and can make a strong argument before you start trying to get people on board . a quick and easy way to show your support for the protection and preservation of wolves , is to sign an online petition . it is likely that there will be an active petition on one of the major online activism websites , such as change . org or addup . org . search around online for petitions to help save wolves and sign up . if there is a specific threat to a wolf population , such as the mexican wolf , there may be specific petitions for this . if you cant find a petition you can always start your own . social media has become a very popular way to try to raise awareness about causes , such as threats to wolves . if you have found an online petition or campaign you can support it by raising awareness through your social media accounts . tweet , like and share information about campaigns to protect wolves to highlight the issues and encourage others to get involved . search for facebook groups dedicated to promoting the protection of wolves and join them . look at the social media presence of key charities and organisations that work to protect wolves and see what clicktivism you can do to help . you can use a hashtag to try to help an issue trend and receive more coverage . one popular hashtag is savewolves . you can become a lobbyist for the protection of wolves by contacting your local political representatives and asking them to highlight the plight of wolves , and support any relevant initiatives and legislation . you can find the names and contact details of your political representatives via the official government website httpswww . usa . govelected - officials you can also get in touch with politicians in areas such as minnesota where the wolf population is under threat . there are many parts of the world where wolf populations are in danger , and there is no reason why you should limit your advocacy to your home country . online activism makes it easy to contact politicians all over the world and ask them to do all they call to help save wolves . one example is the campaign to protect wolves in lapland . you can add your name to a statement criticising this and send it online .

donate to a wolf charity . join an international wildlife charity . adopt a wolf .

how to take action to save wolves 3

you can help to save wolves by supporting the work of national wildlife organisations and charities . there are number of campaign groups whose sole purpose is on protecting wolves and raising awareness of their plight . you will be able to find a number of these groups just by search for wolf protections charities , and save the wolf . you can choose to donate however much you can afford and are comfortable with . you may opt for a direct debit , or to join an organisation via annual subscription . joining an organisation often means you receive news and updates on their campaigns , so it will be easier to keep track of the situation . there are also plenty of international wildlife charities who you can donate to . big groups like the world wildlife fund wwf have campaigns to protect wolves , so your donation can help make a difference . research a few different organisations and choose the one most closely aligned to your views and priorities . when you donate to a large wildlife charity , you wont know what part of their work your money funds . you may not be directly contributing the protection of wolves , but you will be helping support a charity that has a voice and can achieve a lot for wildlife . a fun way to donate to a campaign to save wolves is to adopt a wolf through an organisation , such as the wwf . the wwf have a wolf adoption scheme that you can participate in . you can choose different donation packages to adopt a wolf . depending on how much you donate , 25 , 55 , 100 or 250 , you will need a special wolf adoption pack . the more you donate the more you get in your wolf gift pack . the 25 pack gets you a photo of a wolf , an adoption certificate , and a species card . if you donate more you will get a cuddly wolf toy , and your photo and certificate can be framed .

start researching wolves . research what they eat . research their personality . research their behavior . research their language . research captive wolves . do even more research for multiple years and do wolf related stuff in real life that allows you to interact with or at least see some wolves . test your knowledge . you are now a wolf expert

how to become a wolf expert

use any available sources also , decide whether you want to research any kind of wolf , or just a specific breed , like a timber wolf or an arctic wolf . a wolfs main prey is ungulates such as moose , deer , elk , etc . and things like musk oxen and bison . they are opportunistic feeders though , and will sometimes eat smaller prey , plant buds , berries , etc . wolves are normally social animals with strong bonds , courage and loyalty , although they are afraid of humans . they are not the bloodthirsty killer many think them to be . they do not kill without reason if a wolf attack seems unprovoked , assume there are reasons only the wolf knew - such as the human was on its territory . every wolf is different , too , so some are submissive and others more dominant . its just like with dogs the temperament varies depending on the individual animal . a wolf is born blind and deaf but with a strong sense of smell and the ability to crawl around , in a pack usually made up of two wolves and their other offspring . as they grow their eyes open , and turn blue . their eyes turn yellow , orange , or amber , or in rare cases turn green or stay blue , when they get older . when they are puppies they will drink their mothers milk as newborns then be weaned off of it to eat meat . when they are first weaned off of it they will eat half digested meat the adult pack members regurgitate . then they move onto actual raw meat . for a few weeks the puppies play fight until they determine who is more dominant than the other however , adult wolves still play with each other . to invite another wolf to play a wolf will use the same play bow motion as your average dog . they may also make dancing movements which are also used in courtship . once they get older the pups will begin to follow the adults on a hunt , but not join in hunting . then later they will join pack hunts . the ways a wolf pack hunts can vary . one method is to have several wolves chase the prey to where other wolves are hiding . another method is to surround the prey and then close in on it until it notices the wolves , then charge at it . when the prey falls , before eating it , a wolf will do something called a jaw punch to ensure the prey is dead . it does this by walking towards the carcass , nudging it , and jumping back . if the prey doesnt move the wolves eat . the two parent wolves eat first . some younger wolves may try to interrupt but if they do they are snarled and barked and and have to wait their turn . after a meal is over a wolf pack will cache the leftovers where they may return to eat them later . also , a wolf pack will engage in group howling both before and after a hunt . wolves do not actually howl at the moon but they do howl on lighter nights since those are better nights to hunt on . when landing after jumping their toes splay for balance and grip . they also have two methods of grooming themselves licking themselves and nibbling the fur between their toes . there is much more about wolf behavior though it doesnt end there wolves , unlike dogs , bark rarely . they will , however , emit a soft bark or low woof sound to alert other pack members of danger sometimes . they will growl and snarl , with the hackles raised , fur bristled , lips curled and body tense to show aggression . they curl their tails between their legs with flattened fur and ears to show fear . also , they will lower their ears and narrow their eyes to show suspicion and a head tilt for confusion . they have submission exactly like that of a dog there is either active submission , where they roll over , curl their tail between their legs , flatten their fur and ears , whimper a lot , and avoid eye contact , or passive submission , where they curl their tail between their legs and lower their body very close to the ground . if a wolf ruffles its fur , stares at another wolf , raises its tail , and possibly growls , it is showing dominance . just like dogs , wolves sniff each others rumps to gather information . they do it in the same position too . in courtship a male wolf will hug a female wolfs neck , the two will dance around each other and put their muzzle on each others muzzle , and lick and nuzzle a lot . theyll also sleep side by side and walk side by side , bumping their bodies against each other . then when the time finally comes wolves mate in winter since young elk are born in spring and so are their pups , the female approaches the male and tries to be very playful while the male stands still . also , a puppy will lick , nudge , or nuzzle an adults muzzle to ask for food . research their anatomy , especially if you want to draw a realistic one . wolves have feathery shoulder fur , a blocky muzzle and blocky paws , clumpy belly fur , rough leg fur , fluffy tails , rounded triangle shaped ears , circular eyes and dull claws . they usually have a pelt of black , brown , orange - ish color , grey , or white . white is either an arctic wolf or a very old timber wolf . try going to a place where they have captive wolves like wolf haven international . some captive wolves are fed berries and bits of cheese , and taught tricks remember , though , captive wolves behavior is very different from wild wolves . this is part of the reason that terms like alpha , beta , and omega were debunked . , if you feel you dont have enough to be considered an expert , do a lot more research .

move your guinea pig indoors . move your guinea pigs into the shade . dont keep your guinea pigs in sheds or garages . keep your guinea pig away from windows . refill your guinea pigs water supply regularly . provide more than one water source . feed your guinea pigs hydrating vegetables . use fans and air conditioning . introduce ice packs and such to the cage . look for signs of dehydration . keep your guinea pigs coat groomed . introduce shelters and huts . partially cover the cage with damp cloths and towels .

how to keep your guinea pig cool in hot weather

the most effective way to keep your guinea pig safe from the hot heat is to move them from outdoors to indoors if they arent already inside . the temperature of the whole area already helps them stay cool , especially if you have fans or air conditioning . a good place to keep your guinea pig is in the laundry room or bathroom as these are one of the coolest rooms in the house . make sure heshe is safe from any other pets and younger children . resist from turning the washing machine or dryer on at this time as guinea pigs are sensitive to loud noise and the generator will give off heat and humidity . avoid any direct sunlight that can instantly heat up the cage . the housing your guinea pigs live in can help to be cooled down if you keep them in the shade such as a tree or under the roofing . if you cant physically move your guinea pigs cage into the shade you should opt for bringing them indoors or at least putting a parasol over the cage . you will need to check on your guinea pigs more often however . the heat can be two times worse in these places as the humidity level rises . these areas dont hold a good air flow or ventilation so they trap the heat in . housing your guinea pig in a shed or garage can lead to death so please take caution , your guinea pigs should be kept away from any direct sunlight on them . dont place them near any windows where the sun can directly shine on their cage . you can help get rid of sun seeping through by covering the windows or closing the curtainsblinds . water can evaporate , or even heat up fast in hot weather . guinea pigs will refuse to drink warm water if there is any top up water at least three times on a hot day and feel it to make sure its staying at a cool room temperature . due to the weather conditions water is very important to keep your guinea pigs hydrated and prevent any potential issues from occurring . you can help your guinea pig get plenty of water through providing more than one water source . the more guinea pigs the more water you will need . some guinea pigs dont like sharing as they can be territorial . opt for vegetables that have a higher water content such as cucumbers and berries which will help to ease discomfort in high heat . you can alternatively choose to feed frozen vegetables if you wish . dont overdo it . only feed a few high water content vegetables . this doesnt mean that you should go overboard and feed your guinea pigs a complete diet that only contains vegetables that contain a lot of water . your guinea pig still needs to be getting nutrients from their vegetables . these items are a yes when it comes to using them to keep your guinea pigs cool . but point the direction away from the guinea pigs instead of directly onto them . they can help cool the air , but there is no need to have them directed at the guinea pigs which can stress them out . frozen water bottles , ice packs , gel cushions and cool tiles can all be placed inside of your guinea pigs cage to help insulate cold air and allow somewhere cool for your guinea pig to rest beside . plastic water bottles can be filled with water and then frozen overnight . wrap them in old , chilled tea towels or flannels and place them into the cage . old tiles can be placed in the freezer to cool overnight and then put inside of the cage for your guinea pig to rest on or near . chilled gel packs can also be used as long as your guinea pigs wont chew them hot weather is the time you should be concerned about your guinea pigs health from heat stress to dehydration , long haired breeds can easily suffer from heat stroke due to the insulation from their longer coat . short haired breeds are less prone however . your long haired guinea pig should be monitored closely . if you want to lighten the heat stress on your guinea pig consider trimming its coat and keeping it well groomed . guinea pigs like to hide away from the sun which helps reduce their stress levels . ensure your guinea pig has access to some hide away or huts but avoid anything made from plastic which can heat up quickly . the dampness can help insulate cool air in the cage and ultimately reduce heat stress . rinse the cloth in ice cold water and make sure you drain it off afterwards . dont place the cloth over the food bowl which can spoil the pellets and only cover part of the cage to ensure that you can see the guinea pigs and they can see you .

compare the body sizes of the two animals . look at the size of each animals head . examine the tail of the animal . examine the coat of each animal .

how to tell a jaguar from a leopard 1

one of the biggest differences between jaguars and leopards is their physical size . leopards are generally smaller than jaguars , though size discrepancies exist within each species . jaguars can grow up to 6 . 25 feet long 1 . 9 meters . adult jaguars can weigh up to 211 pounds 96 kilos and stand 25 to 30 inches 76 centimeters tall at the shoulders . leopards can grow up to 6 . 3 feet 1 . 92 meters in length and weigh up to 198 pounds 90 kg . leopards are taller than jaguars , with adult leopards standing up to 31 inches 78 . 74 centimeters tall at the shoulders . another physical distinction between jaguars and leopards is the size of each animals head . jaguars typically have much larger heads than leopards , which makes sense given the overall body size difference between these two cats . the size and patterns on each animals tail can be another distinguishing feature . the tail of a jaguar is typically shorter than the tail of a leopard . a jaguars tail patterns are also unique the rosette patterns on the tail may appear to merge , forming a band around the tail . though jaguars and leopards have very similar - looking coats , there are some noticeable differences between the two . close examination of the patterns and coloration can often reveal which animal is which . while both animals have rosette patterns on their coats , a leopards rosettes are solid . a jaguars coat will have spots inside the rosettes , setting it apart from those of a leopard . the rosettes on a jaguars coat are usually much larger , whereas a leopards rosettes are typically very closely - spaced together . a jaguars base coat color is usually a shade of yellow , but it can also be reddish - brown or even darker . the throat , outer legs , underbelly , and lower flanks are usually white though they may have spots . both animals can have an all - black coat , but a black leopard will still show a rosette pattern on its black coat . a black jaguars coloration can also appear more like a mix of blueblack and purple .

check whether the animal carries prey into a tree . observe how the animal behaves around water . notice the way the animal fights other animals .

how to tell a jaguar from a leopard 2

leopards and jaguars are both skillful hunters , but leopards are the only known big cat that carries its dead prey into a tree . leopards also climbjump out of trees headfirst . if you witness the animal carry its prey into a tree , it is definitely a leopard . however , that doesnt necessarily mean that leopards will do this every time . there is a distinct behavioral difference between leopards and jaguars when it comes to being in the water . both jaguars and leopards are skilled swimmers , but jaguars will actively spend time in water , whereas leopards will generally try to avoid being in the water as much as possible . both cats are strong , skillful predators . however , jaguars are typically more willing than leopards to fight a larger animal species . leopards , by contrast , will usually run away from larger creatures like lions , anacondas , or even hyenas .

learn the geographic regions of each animal . consider a jaguars typical habitat . know a leopards typical habitat .

how to tell a jaguar from a leopard 3

while physical and behavioral characteristics are the easiest ways to distinguish between a jaguar and a leopard , you can also identify the animal by its geographic location . these two big cats naturally live on opposite sides of the world , though of course some individuals may be kept in captivity in other regions . jaguars live exclusively in north america , central america , and south america , and may not be able to survive in a leopards habitat . leopards live in african and asian countries , and may not be able to survive in a jaguars habitat . in addition to geographic location , it may also be helpful to know the animals preferred environment . jaguars are somewhat diverse in their habitat selection , though they typically inhabit rain forests , flooded wetlands , swamps , and dry grasslands . though they live on different sides of the world , leopards and jaguars often reside in similar habitats . leopards can inhabit a broad range of habitats , including woodlands , grasslands , mountains , deserts , and rainforests . the specific habitat a leopard inhabits depends largely on which continent it resides in .

approach your guinea pig calmly . place your right hand around your guinea pigs front end . avoid squeezing your right hand . put your left hand under your guinea pigs bum . lift up your guinea pig horizontally . hold your guinea pig close to your body .

how to pick up a guinea pig 1

animals can sense nervousness in humans . when handling animals of any kind , including guinea pigs , you need to remain calm and confident while around them . if you arent able to keep calm for any reason , wait to handle your guinea pig at a time when you are calm . try talking to your guinea pigs so they arent startled when you try to pick them up . there are two possible ways to place your right hand on your guinea pigs body . the two methods are outlined heremethod 1 — place your right hand on top of your guinea pig , across his shoulders . place your right thumb behind your guinea pigs front legs . and then place your right fingers in front and behind your guinea pigs front legs e . g . one or two fingers in front of his front leg , two to three fingers behind his front leg . method 2 — place your right hand under your guinea pigs chest , near his front legs . put your index finger in front of your guinea pigs left front leg , and the rest of your fingers behind his left front leg . use your index and second fingers like scissors to hold your guinea pigs left leg still . your hand should be placed on your guinea pig gently but firmly and without applying any pressure . squeezing your hand may cause your guinea pig to squirm , which in turn may cause him to injure himself . once youve gripped your right hand around the front of your guinea pig , place your left hand behind his bum . make sure you have his behind fully supported with your left hand . lift your right hand up so your guinea pigs front legs are off the ground . then support the back end of your guinea pig with your left hand . make sure your guinea pigs back legs are always supported , do not allow them to dangle . if your guinea pig struggles when you pick him up , you may need to hold his back legs still with your left hand and fingers . once your guinea pig is off the ground , move your arms so that hes close to your chest and body . cuddle your guinea pig against your body while hes off the ground and youre moving around . guinea pigs feel safe and comfortable when theyre either against your body or if they have their feet on the ground .

use treats to entice your guinea pig to like you . handle your guinea pig often . be careful when your guinea pig struggles . put your guinea pig into his cage backwards . wait to release your guinea pig when he stops squirming . do not hold your guinea pig too long .

how to pick up a guinea pig 2

when first trying to pick up your guinea pig you need to gain his trust . start by allowing your guinea pig to sniff your hand and fingers before you touch him . use treats as incentive for your guinea pig to get closer to you and like you . treats can include small pieces of fruit like oranges , plums , berries , grapes , bananas , watermelon , or cantaloupe . treats can also include small pieces of vegetables like basil leaves , turnip greens , bell peppers , romaine lettuce , clover , cilantro , cucumber , tomatoes , celery , corn , dandelions , kale , and chard . the following food can be fed to your guinea pig as a treat , but no more than two times a week parsley , carrots , and apples . the best way to allow a guinea pig to build a bond with you is to hold him as often as you can . at a minimum you should hold your guinea pig at least once a day . guinea pigs , unlike hamsters and gerbils , dont usually bite when theyre scared . instead , a guinea pig will squirm and struggle in your hands , hoping youll drop him or put him down . if your guinea pig struggles while youre holding him , be careful not to squeeze him in an attempt to stop the squirming . if your guinea pig decides he wants to bite you , make sure your place your hands where he cannot reach them . when you move to put your guinea pig back onto the floor , or into his cage , be aware that he may attempt to jump out of your hands . as jumping out of your hands could injure your guinea pig , a trick you may want to employ is to put your guinea pig down backwards . if your guinea pig cant see where hes going , he will be less likely to jump out of your hands . when attempting to put your guinea pig back into his cage , do not release him from your hands until he stops squirming . hold your guinea pig firmly , but gently , a few inches off the ground or floor of the cage and wait until he stops squirming . once your guinea pig stops squirming , place his feet on the floor of his cage . do not release him from your hands until he stops squirming . even a guinea pig who likes to be held may eventually want to be put down . for example , your guinea pig may need to pee and want to go back into his cage . if your guinea pig starts to struggle and lick your hand , he may want to be put down . if your guinea pig starts to lick your hand , but then settles down again , he may be okay . but if he continues to lick your hand and struggle , you should probably put him back in his cage . on average a guinea pig may only want to be held for 10 - 20 minutes at a time . if you hold your guinea pig for too long , it is possible hell pee or poop on you you may want to hold your guinea pig on your lap , on top of a towel , in case of an accident .

choose a cage with smooth flooring . select a large cage for your guinea pig . place soft , comfortable bedding in the cage . make sure the cage gets fresh air . clean your guinea pigs cage . check your guinea pigs feet daily . trim your guinea pigs nails . feed your guinea pig a diet high in vitamin c . too little vitamin c can cause foot sores in guinea pigs . a healthy diet with enough vitamin c will help keep your guinea pigs feet healthy and free of sores . monitor your guinea pigs weight . encourage your guinea pig to exercise .

how to prevent your guinea pig from developing foot sores

wire flooring is not good for your guinea pigs tiny feet . this type of flooring could easily damage his foot pads , increasing his risk of developing foot sores . smooth flooring would protect your guinea pigs feet and help prevent foot sores . if your guinea pigs current cage has wire flooring , switch to a cage with smooth flooring . your guinea pig needs space to run and play . since exercise can prevent foot sores , make sure his cage gives him plenty of space to run around . if you have 1 guinea pig , his cage should be 42 x 24 x 18 inches 106 x 61 cm x 46cm . if you have multiple guinea pigs , you will need an even bigger cage so each guinea pig has space to exercise . the staff at your local pet store can help you decide what size cage you will need . rough bedding can leave cuts and scrapes in your guinea pigs foot pads . to prevent him from getting foot sores , use cage bedding that is soft , thick , and dry . examples of ideal bedding are fleece and carefresh® . place about 2 to 3 inches of bedding in the bottom of the cage . bedding types to avoid are cedar pine shavings , corn cob bedding , and straw . replace the bedding when it becomes wet and dirty . clean , dry bedding will help prevent foot sores . good air flow can keep your guinea pigs cage from getting humid and damp . fresh air can also prevent the cage bedding from getting wet . the drier his cage , the less likely hell get foot sores . place his cage in a draft - free area where there is good air flow . if the cage has solid sides , cover the cage top with a wire mesh lid to allow for good air flow . a clean cage is important for preventing foot sores . each day , do a quick spot clean to remove excess food , clean up urine and feces , and replace wet and dirty bedding . you should also clean and refill his water and food bowls each day . change his bedding completely at least once a week . do a thorough cage cleaning once a week . remove all bedding and accessories from the cage and clean the cage with hot , soapy water . rinse the cage and allow it to dry completely before placing everything and your guinea pig back in . a dirty cage can have a buildup of a bacteria that could infect your guinea pigs footpads . the more often you look at your guinea pigs feet , the sooner you will notice if his feet need to be treated . look at his feet each day . his foot pads should be smooth and light pink . if you notice anything abnormal e . g . cuts , scrapes , swelling , contact your vet . your vet may need to treat your guinea pigs feet with an antibiotic ointment . your vet may recommend some products you can use at home to treat minor cuts and scrapes on the foot pads . check your guinea pigs feet during a time when you would normally handle him . long nails can curve around and under your guinea pigs feet , making walking difficult . if the nails are too long on one foot , your guinea pig will start putting pressure on another foot that foot will then develop foot sores . trimming your guinea pigs nails will help prevent foot sores . if youre not comfortable trimming the nails , ask your vet to do so . since guinea pigs cannot produce their own vitamin c , they need to get it from their diet . vitamin c - rich foods include bell peppers , parsley , and kale . guinea pig pellets usually contain vitamin c . however , after about 3 months , the vitamin c in the pellets loses its strength . try not to feed your guinea pig pellets that are more than 3 months old . vitamin c supplements are available for guinea pigs . however , do not add vitamin c to water—much of the vitamins strength will be lost in a day , and you will not be able to tell how much your guinea pig is actually getting . your vet can determine if your guinea pig has a vitamin c deficiency and provide suggestions on how to correct it . obesity can cause foot sores in guinea pigs by putting too much weight and pressure on the feet . if you can keep your guinea pig at a healthy weight , you can prevent him from getting foot sores . your vet can determine if your guinea pig is overweight and what his weight should be . at home , you can weigh your guinea pig with a kitchen scale . weigh him on a weekly basis . increased exercise and dietary changes can help a guinea pig lose weight , if necessary . obesity in guinea pigs is not very common . before changing your guinea pigs diet or increasing his exercise , have your vet confirm that obesity caused the foot sores . exercising will prevent foot sores by keeping your guinea pig at a healthy weight . place an exercise wheel with solid flooring in his cage the solid flooring will prevent foot injuries . you can also put his sleeping area , food bowl , and water bowls in different locations to encourage him to move around more . little toy balls , food toys e . g . piece of produce in a brown paper bag , and chewing items e . g . timothy hay , untreated apple branches can also motivate your guinea pig to exercise .

consider whether your guinea pig was in the presence of a boar . observe her eating habits . check her weight . feel for piglets .

how to tell if your guinea pig is pregnant 1

boars are male guinea pigs . if a female guinea pig has been in the presence of a boar , then she will have almost certainly tried to mate and has a high chance of becoming pregnant . male guinea pigs can impregnate a female at as young as 3 weeks old and a female guinea pig can become pregnant at as young as 4 weeks old , so dont be doubtful if your guinea pig is pregnant due to age . a pregnant sow will begin to drink and eat more as the pregnancy advances . she may eat up to triple the amount she usually consumes . she may also drink more water than normal . keep in mind that normal is relative to your guinea pigs usual habits . however , do not assume that your guinea pig is pregnant based on just how much she is eating or drinking . all animals , for example , tend to eat more when its cold , when theyre having a growth spurt , and when theyre suffering from certain illnesses . a female guinea pigs weight will increase significantly if shes pregnant . guinea pigs typically weigh about 1 . 5 - 2 lbs . in general , by the end of a pregnancy , the pregnant guinea pigs weight will have doubled the piglets usually make up more than half of the sows weight . a good idea is to weigh your female guinea pig regularly perhaps weekly and to record the weight . this way you can keep track of her weight in order to determine any patterns of weight gain that may be indicative of a pregnancy . however , if your sow is not yet mature and is less than 6 - 8 months of age , she will still be growing and thus weight gain may not be indicative of pregnancy . if you feel your guinea pigs womb very carefully , you may be able to detect the fetuses if she is pregnant . usually , you can identify the fetuses in her womb from around 2 weeks after mating . treat the sow with care and never handle her roughly . when feeling your guinea pigs abdomen , never apply pressure or squeeze the area since this could harm both the piglets and the sow . to feel for fetuses , place the sow on a towel on a firm surface . this will keep your guinea pig from slipping . with your non - dominant hand hold her steady around the shoulders , with her head facing away from you . use your dominant hand to feel her belly . begin by making a c shape with your thumb and first finger , and then sliding the thumb over the top of her tummy and the forefinger underneath her belly . gently press inwards and see if you feel any lumps or bumps inside her tummy . if pregnant , your guinea pig may have a single piglet or up to 3 - 4 . if several fetuses are present , you will feel several bumps spaced across her tummy , each of a similar size . however , be aware that other things can feel like bumps in the abdomen . the kidney , bladder , or even fecal pellets can all be easily mistaken for fetuses . bumps can also indicate ovarian cysts or tumors . if you feel something and youre not certain what it is , then consult your veterinarian .

make an appointment with your vet . have your vet do a physical examination . have your vet do an ultrasound . ask for advice in caring for guinea pig if she is pregnant .

how to tell if your guinea pig is pregnant 2

if you suspect that your guinea pig is pregnant , then its imperative that you consult a vet . you will not be able to tell for sure until the guinea pig is examined and assessed by a skilled veterinary professional . if you need to transport your guinea pig , never pick her up by her stomach as it can harm the unborn guinea pigs and the mother herself . youll need to encourage her into a transport cage through treats or her favourite vegetablesfruit . a veterinarian will be able to feel around your guinea pigs stomach and differentiate between the different lumps and bumps , something that you may not be able to do effectively on your own . your vet should be able to tell whether or not your guinea pig is pregnant through a physical examination , but may also recommend additional testing , such as an ultrasound see below . you vet may also be able to hear the piglets heartbeats in the sows abdomen . an ultrasound scan is the gold standard for pregnancy diagnosis among guinea pigs . unlike in other species , the stress of taking blood can adversely affect the health of pregnant guinea pigs . moreover , there is no commercial pregnancy test available for guinea pigs . an ultrasound scan can visualize exactly what the bumps are and confirm a pregnancy . the ultrasound exam involves involves clipping a small square of fur and applying gel to the exposed skin . then , the ultrasound probe is placed on skin and emits a high - frequency sound that is inaudible to human ears . the probe records the echoes as the sound waves bounce back in order to determine the size , shape , and consistency of internal tissues and organs . this information is then translated into an image . in other words , you will be provided with a visual of your guinea pigs abdomen and the doctor can then confirm or disconfirm a pregnancy . ultrasounds are non - invasive and do not require sedation . if the vet confirms that your pig pregnant , then it is important that you make sure you know how to properly care for her . a pregnancy puts stress on the sows organs and circulation system . moreover , any rodent that is pregnant carries a one in five chance of dying as a direct result of complications during or after pregnancy or birth .

have the information of a vet . remove any male guinea pigs . make sure your guinea pig has enough food and water . weigh your pregnant sow regularly . minimize your guinea pigs stress .

how to tell if your guinea pig is pregnant 3

in many cases , you can allow the pregnancy to proceed normally , but make sure you have a vet on hand in case there are complications , which are more likely if your pig is older or younger or has not given birth previously . try to find a vet who specializes in rodents and other small animals , rather than just a generic vet . if you have multiple sows , remove the male pig immediately to prevent others from becoming pregnant . even if this is the only sow you own , you should still remove the male pig before she reaches 60 days in her pregnancy . it is best to house the male in an adjacent cage where he can still be close to the female . a male guinea pig who can not see or hear his mate may develop stress , making him susceptible to illness . male guinea pigs will continue to mount pregnant sows , which can cause stress or pain to your pregnant sow late in the pregnancy after the 50 - day mark . she could also become pregnancy just two hours after she gives birth . youll want to make sure your pig is getting sufficient food , water , and nutrients since these things are also helping the fetuses develop . feed your guinea pig alfalfa hay instead of timothy hay so that she gets more protein and calcium . your pregnant sow will also need more vitamin c after 4 weeks , about twice as much , so incorporate more fresh fruits and vegetables high in vitamin c into her diet . in addition , you may want to increase your guinea pigs fiber intake . increased fiber intake can prevent hair thinning , which is common in the last stage of pregnancy . you should weigh your guinea pig twice a week to make sure that is gaining weight and not losing it and is generally healthy e . g . eating all her food , still social and interactive , etc . and check shes healthy . if at any point her weight begins to fall or if she begins to show signs of illness , consult a vet immediately . try to make your guinea pigs life follow a routine so as to minimize stress , which can aggravate the dangers that accompany guinea pig pregnancy . avoid making changes to a pregnant sows cage , like removing toys or putting the cage in a totally new location . this could increase her stress and affect her eating and drinking habits . reduce her exposure to loud noises or bright lights , including direct sunlight . reduce handling to a minimum and dont handle her within two weeks of the birth . note that the gestation period is usually 66 - 72 days .

determine if your guinea pig has trouble breathing . look at your guinea pigs eyes and nose . take note of your guinea pigs appetite . have your vet diagnose your guinea pig . treat your guinea pig immediately . hospitalize your guinea pig , if necessary . have your vet correct your guinea pigs dental problems . give your guinea pig antibiotics . monitor your guinea pig . clean your guinea pigs cage regularly . use proper bedding in your guinea pigs cage . keep your guinea pigs cage well ventilated . do not overcrowd your guinea pigs cage . do not house rabbits and guinea pigs together . add vitamin c to your guinea pigs diet .

how to treat respiratory problems in guinea pigs

when your guinea pig is healthy , his breathing will be quiet and easy . however , respiratory problems can make it hard for him to breathe . your guinea pig may start wheezing . in addition , you may hear clicking or rattling noises when he breathes . a respiratory problem can cause your guinea pigs eyes and nose to produce discharge . if the discharge is green or yellow , your guinea pig could have a bacterial respiratory infection . a respiratory infection could also cause your guinea pigs conjunctiva , the inner part of your guinea pigs eyelids , to become red . allergies , another type of respiratory problem , can make your guinea pigs nose red and sore from a lot of itching and scratching . a respiratory problem can make your guinea pig feel pretty sick and not in the mood to eat . he may eat less , or not at all . when you feed him , observe how much he eats . with a reduced appetite , your guinea pig will lose weight . a lack of vitamin c is one possible cause of respiratory problems in guinea pigs . if your guinea pig is not eating much because he feels sick , he may not be getting enough vitamin c , which could make him feel even worse . although your guinea pig may have obvious symptoms of a respiratory problem , your vet will need to determine the exact cause of the illness and how serious it is . to do this , they will perform a physical exam that will include listening to your guinea pigs lungs . your vet will also take samples e . g . nasal swab , discharge from the eyes or nose to identify the specific bacteria causing the respiratory infection . chest x - rays can also help your vet diagnose your guinea pigs respiratory problem . chest x - rays will show whether your guinea pig has pneumonia . dental disease can cause respiratory problems in guinea pig because the roots of the cheek teeth premolars and molars are so close to the nasal passages . if your guinea pig has dental disease , skull x - rays will help your vet see the extent of the disease . if left untreated , your guinea pigs respiratory problem could make him extremely sick . for example , if he has a cold , it could quickly progress to pneumonia , which may be difficult for him to recover from . the sooner you get him treated , the better his chances of a good recovery . if your guinea pig is extremely sick e . g . very labored breathing , inability to eat , very weak , your vet will likely want to hospitalize him for intense treatment . in - hospital treatments include assisted feeding , injectable medications , and extra oxygen . your vet will want to hospitalize your guinea pig until he is strong and stable enough for at - home care . if your guinea pig has severe breathing troubles , your vet may also humidify the oxygen your guinea pig is receiving . your vet may give your guinea pig an oral or injectable multivitamin in the hospital if he is extremely weak . injectable medications usually work faster than oral medications . if dental disease caused your guinea pigs respiratory problems , then your vet will need to treat it at the hospital . your vet will need to anesthetize him and use specialized dental tools to work on his teeth . after surgery , your vet may prescribe a pain medication for your guinea pig . two types of bacteria — bordetella bronchiseptica and streptococcus pneumoniae — are the primary causes of respiratory infections in guinea pigs . your vet will use diagnostic test results to select which antibiotic will effectively treat your guinea pigs respiratory problem . follow your vets instructions carefully to ensure all the bacteria is killed . the medication may come in liquid or pill form . if the antibiotic comes in liquid form , you can use a medicine dropper to put the prescribed number of drops into the corner of your guinea pigs mouth . if he resists that , you could place the drops on his favorite food . to give your guinea pig a pill , place the pill back by your guinea pigs molars so he wont be able to easily spit it back out . consider putting the pill in a hemostat clamps that look like scissors to place and then release the pill in his mouth . hemostats are available at your local drug store . contact your vet if you are having trouble giving your guinea pig the antibiotics . some antibiotics can cause diarrhea in guinea pigs by killing the healthy bacteria in the digestive tract . if your guinea pig develops diarrhea from the antibiotics , stop giving them immediately and contact your vet . your guinea pig will probably need to be treated with a different antibiotic . once your guinea pig has been treated for a respiratory problem , you wont want him to get another one . keeping his cage clean is one of the best ways to prevent a future respiratory problem . clean his cage twice a week . to give your guinea pigs cage a thorough cleaning , remove all cage accessories and discard the bedding . wash the cage with hot , soapy water . rinse the cage and let it dry completely . each day , remove leftover food , feces , and dirty bedding . proper bedding can also prevent respiratory infections in guinea pigs . dust - free bedding will not irritate your guinea pigs nose . examples of dust - free beddings are carefresh® and fleece . do not use cedar or pine shavings . these shavings contain oils that can be very irritating to a guinea pigs respiratory tract . replace the bedding whenever it becomes soiled or wet . damp bedding can become moldy and increase your guinea pigs chances of getting sick . adequate air circulation is important in preventing respiratory problems in guinea pigs . a wire cage would provide more ventilation than a solid glass cage . make sure the cage is not in the direct path of a vent or draft — a constant draft of cool air could make your guinea pig sick . if you have multiple guinea pigs , they should be in a cage large enough to house all of them comfortably . if the cage is too small , your guinea pigs could develop respiratory infections from the stress of overcrowding . the stress would weaken their immune systems and make them susceptible to infection . if you have 2 guinea pigs , their cage should be at least 30 inches x 50 inches 76 cm x 127 cm . rabbits can harbor bordatella in their bodies and pass it on to guinea pigs . in addition , a rabbit can bully a guinea pig , causing the guinea pig stress if it cannot find a safe place to get away . to prevent a respiratory infection , house your rabbits and guinea pigs in different cages . the stress from bullying could cause a respiratory problem by weakening your guinea pigs immune system . adequate amounts of vitamin c are essential to preventing respiratory problems in guinea pigs . guinea pigs cannot produce vitamin c in their bodies , so they must get this nutrient from food . examples of vitamin c - rich foods are broccoli , parsley , green peppers , and mustard greens . vitamin c dietary supplements are also available . talk to your vet before giving your guinea pig a supplement . your guinea pig should receive 50 mg of vitamin c per day . your vet can help you ensure that your guinea pig receives enough daily vitamin c .

seek veterinary treatment . discuss treatment challenges . allow your vet to surgically remove the lump . have your vet lance and drain the abscess . allow your vet to inject the abscess with antibiotics . place your guinea pig in a quiet environment . give your guinea pig antibiotics . clean the affected area . schedule a follow - up appointment . remove sharp objects from the cage . separate fighting cage mates . correct dental problems .

how to treat lumps in guinea pigs

lumps on guinea pigs often require veterinary treatment . frequently , treatment involves surgical removal of the lump . if the lump is infected , your guinea pig would need antibiotics to prevent the spread of infection after surgery . do not try to treat a lump on your own . removing a guinea pigs lump can be challenging . if the lump is infected , surgically removing it could release bacteria into the bloodstream , causing a serious condition called septicemia . also , the pus within a guinea pig abscess has a thick , cheese - like consistency , making the typical abscess treatment—lancing and draining—ineffective in many cases . lancing an abscess involves cutting it open with a sharp instrument . sometimes , abscesses can form finger - like extensions and extend into nearby tissues , making complete removal difficult . mouth abscesses are very challenging to treat because of their location . they can swell and block the throat . in addition , if the abscess breaks open , the pus could fatally choke a guinea pig . removing a cyst may be challenging as well , since the fluid inside of it may contain bacteria . if your guinea pig can undergo surgery , your vet will anesthetize your guinea pig and remove the lump . in most cases , a guinea pig can go home on the same day of surgery . however , if your guinea pig has a mouth abscess , your vet may want to hospitalize your guinea pig because of the potential for serious health problems . for an abscess , complete removal is very important . if the removal is incomplete , the abscess could come back . surgical removal of a skin tumor is curative , meaning that no other treatment is needed to treat the tumor . lancing may be a good option for mouth or jaw abscesses . after anesthetizing your guinea pig , your vet would first cut open the abscess and drain the fluid with a surgical drain . next , they would flush the empty abscess with an antiseptic solution . then , your vet may pack the empty abscess with antibiotic beads . be aware that this treatment option makes it more likely for an abscess to come back . flushing the abscess means to fill it with a liquid solution the antiseptic , then suction the liquid back out . your vet may have to flush the abscess several times to make sure all of the pus is out . the antibiotic beads would be effective for 2‒6 months . not all abscesses require surgical removal . if your guinea pigs abscess is less than 1 cm in diameter , your vet could inject antibiotics directly into the abscess . your vet would inject the antibiotic into the abscesss wall . alternatively , your vet may want to flush the abscess periodically , rather than removing it . flushing the abscess periodically will help prevent the abscess from causing problems . your vet will let you know how often the abscess should be flushed . when you bring your guinea pig home after surgery , let it recover in a calm , quiet area . place your guinea pigs cage in an area that does not get a lot of foot traffic from you or other members of your household . if you have other guinea pigs , keep them in a separate cage from the sick guinea pig . if the surgically - removed lump was an abscess or infected cyst , your guinea pig will need antibiotics to prevent post - surgical infection . because certain antibiotics can make guinea pigs extremely sick , your vet will prescribe a guinea pig - safe antibiotic . do not purchase antibiotics at a pet store they may not be safe for your guinea pig . guinea pigs typically need at least one round of antibiotics following surgical removal of an abscess . your vet will determine how long your guinea pig will need antibiotic treatment . to give the antibiotic pill , hold your guinea pig , open its mouth , and put the pill as far back in the mouth as you can . if you can place the pill near the molars , your guinea pig will not be able to spit it back out easily . give the full course of antibiotics . do not stop the antibiotic treatment when your guinea pig starts looking and feeling better . this could lead to the growth of antibiotic - resistant bacteria . after surgery , keep the incision site clean and free of dirt and debris . to clean the incision site , use a clean , slightly damp towel and gently dab around the incision . that area may be a little painful for your guinea pig , so you do not want to use too much pressure . examine the incision site for signs of infection redness , swelling , discharge . if the incision site looks abnormal , take your guinea pig to your vet for treatment . your vet may want to see your guinea pig again after surgery to monitor its recovery . during this follow - up appointment , your vet will examine the incision area , remove sutures if necessary , and generally assess how your guinea pig is doing . you will not be able to prevent tumors , but you can prevent abscesses and cysts . because abscesses and cysts form after a puncture wound , remove anything sharp or rough from your guinea pigs cage . for example , straw bedding can pierce a guinea pigs skin . instead of straw bedding , use paper bedding like carefresh® or yesterdays news cat litter . if any of your guinea pigs toys have sharp edges , take those out as well . ideal toys for a guinea pig cage are empty toilet paper or paper towel rolls , since they are soft and smooth . make sure your guinea pigs food does not have any sharp edges that could damage his gums . if you house several guinea pigs together , separate them if they fight or bully each other . when they bite each other , that bite wound can become infected and form an abscess or cyst . malocclusion improper teeth alignment is a common dental problem in guinea pigs . if the teeth do not line up properly , they can overgrow and puncture the inside of the mouth . this puncture wound can lead to abscess or cyst . if your guinea pigs teeth are misaligned , take your guinea pig to your vet for treatment . correcting dental problems in guinea pigs requires surgery . your vet will use specialized dental instruments to trim and realign the teeth .

get together enough grids for the cage for two guinea pigs you will need a minimum of two grids wide and four grids long . connect the grids to form the perimeter of the cage 12 grids24 connectors for a two by four cage , or 14 grids28 connectors for the preferred size cage for two guinea pigs . measure and mark the coroplast using a tape measure , yardstick and pen . cut it to the outer dimensions with the scissors or box cutter . measure and mark 6 in from all sides the inner dimensions . score the coroplast along these lines using a razor blade or box cutter . cut all the way through the coroplast at each corner , just 6 in , to create the flap to make the corner . snap the edges away from the score line to form a box . secure the flaps on the outside with clear packing tape . place the box inside the connected grids . add bedding , hiding areas , food dishes , water bottle , hay holders , toys , and guinea pigs . check that it is sturdy . set up the cage indoors . for pictures to go with the instructions , visit httpguineapigcages . comhowto . htm

how to pick a cage for a guinea pig

, add 12 inches 30 . 5 cm to the length and width for a 6 inch 15 . 2 cm wall all the way round . this gives you the outer dimensions to cut photo is just to give you a perspective . if the cage is going against a wall , you may want to make the back wall 12 inches 30 . 5 cm high to help prevent hay spillage . in that case , youll add a total of 18 inches 45 . 7 cm to the original measurement from above , for one 12 side . a pair of heavy duty scissors or a box cutter is easier than regular scissors , but you can still use regular scissors . cut lines depend on how big of a sheet you are starting with partial sheet shown . , scoring with the grain takes less pressure than scoring against it . , a couple of wide strips on the outside work great . the cage is now finished . , outdoor cages are not appropriate for guinea pigs due to temperature fluctuations , high risk of illness and parasites , and the fact that even secure outdoor cages can be gotten into by predators or stray dogs .

approach your hamster cautiously with both hands . let your hamster sniff you so it knows youre not a predator . bury your hands in the bedding and move your hand under the hamster . scoop your little friend up into your hands . hold your hamster for a minute or two , then put it back in its cage . hamsters need to get used to your voice , so sing softly to it . or whatever , repeat 3 to 4 times a day until your little cutie just runs up to your hand .

how to pick up a hamster for the first time

make sure your palms are down . , remember . quietly .

provide enough room for your guinea pig . ensure the lid is secure . choose the right bedding . keep your piggie at a comfortable temperature . check wooden housing elements regularly . only use rounded mirrors . use a cage with solid flooring . feed your guinea foods that will not hurt it .

how to keep your guinea pig safe 1

if your guinea pig does not have enough room to move about , it will be unhappy , stressed , and might hurt itself . to avoid this , ensure that your guinea pig can exercise and move freely in its cage . your guinea pig should be housed in a space that allows it to stand on its hind legs . a safe guinea pig home will have at least 7 . 5 square feet 2 . 3 square meters . if the lid to the cage is not secure , your guinea pig might find a way to escape . alternately , cats , ferrets , or other pets might get into the guinea pigs cage and hurt it . there are many ways to secure the lids of guinea pig cages . the right method for securing your cage depends on the type of cage you have . some guinea pig cages , for instance , have a sliding handle mechanism that keeps the guinea pig from escaping . others have a plastic door that snaps open and shut . consult manufacturer directions for more information regarding how you can ensure the lid of your guinea pig cage is secure . the particulate matter in dusty bedding can cause breathing problems in your guinea pig . unsafe bedding includes pine powder and other dusty bedding . use dust - free hay , pellet bedding , aspen , or shredded paper instead . if your guinea pig is either too hot or too cold , it could fall ill . therefore , keep your guinea pigs cage out of direct sunlight and away from fans , air conditioners , and vents . guinea pigs should be kept between 65 and 75 degrees fahrenheit 20 - 25 degrees celsius . if you incorporate wooden huts or tunnels into your guinea pigs cage , check them regularly for splintering . since guinea pigs love chewing on wood , they might chew these wooden objects in such a way that they develop sharp edges . some people like to include mirrors in their guinea pigs cages . but mirrors with sharp edges could injure your guinea pig . if you choose to include a mirror , ensure it is round . alternately , use a mirror with edges that are covered with rubber or plastic . you might also choose to place a mirror outside , rather than inside , the guinea pigs cage . while its best to choose a cage with barred sides to increase air flow , a cage with barred flooring could cause foot injuries . therefore , avoid cages with barred floors . the staple of your guinea pigs diet should be grass hay . acceptable varieties of grass hay include botanical hay , oat hay , alfalfa hay , timothy hay , and orchard grass . dont give your piggy pellets that contain additives , human cereals , seeds , or peanuts . these hard objects present choking hazards . give your guinea pig a variety of grass hay so that it wont get bored with its meals , and will receive a variety of nutrients . dont feed your guinea pig lawnmower clippings . they might cause your guinea pigs stomach to get upset .

use a cage that is a tank . clean the cage and add extra bedding . remove the wheel and toys from cage . remove other hamsters from cage .

how to take care of a hamster that is giving birth 1

when preparing for your hamster to have her babies , use a cage that is tank - like , i . e . like a fish tank with glass walls . you want to use a tank - like cage because it reduces the risk of the babies escaping through the wire bars , if the cage you have is a wire cage . also , you want to have a cage that is only one - story high . cages that have multiple stories can cause the mother to make her nest on one of the second or third floors . this is risky because one of the hamster babies could fall and hurt themselves or die . you want to clean the cage 3 to 4 days before the mother goes into labor . clean the cage as you normally would , but add extra bedding . pad the cage with extra bedding material that you usually buy . you can also add shredded pieces of toilet paper for extra bedding . however , do not use commercial fluff or wool to add extra bedding . this kind of bedding can cause harm if the hamster eats it or if one of its limbs becomes caught in the fine fibers . signs that mother is pregnant and will be going into labor are a sudden increase in weight gain , nipple protrusion , an aggressive temperament , nest building , and an increase in eating and drinking . also , remove the hamster wheel , any hamster toys , and tubestunnels that are inside the cage . you want to remove these because they can injure the hamster babies . if your pregnant hamster is sharing a cage with other hamsters , move these hamsters to another cage . these hamsters might disturb the mother and her preparations , or they might harm or eat the babies once born .

monitor your guinea pig during floor time . prevent access to unsafe spaces . remove potentially dangerous items . choose safe toys . keep toxic substances away from your guinea pig . handle your guinea pig gently . dont give your piggie running wheels . avoid buying wired hay racks .

how to keep your guinea pig safe 2

when you take your piggie out of its cage to play and explore , do not leave it alone . always keep an eye on it . let other family members know that youll be playing with your guinea pig before you begin your play session . you might also encourage them to knock before entering , thereby giving you time to collect your guinea pig , lest it run off while the door is open . letting your family members know your piggie is out will also spur them to watch their step when passing through the area you and your guinea pig are playing . take steps to prevent your guinea pig from escaping or getting into areas it shouldnt during floor time . for instance , roll up a heavy towel and lay it in front of nearby doors . do the same for the gap beneath your refrigerator . choose a play space that doesnt have many areas that a guinea pig could escape into , hide under , or run behind . for instance , playing right next to your bed might not be a good idea , since if your guinea pig decided to run beneath the bed , it might be difficult to get it out . ensure all electrical cords , plastic bags , and other sharp and potentially dangerous objects are out of reach . some houseplants can be poisonous to guinea pigs , so dont play with your guinea pig near houseplants . and if you have cats or other pets that could pose a threat to your guinea pig , take them to another room before taking your guinea pig out to play . there are a wide variety of acceptable toys for guinea pigs , including unpainted wooden blocks , and bird toys with bells on them . all safe toys will be free of small plastic pieces that could break off and pose a choking hazard . they will also be free of sharp edges . do not buy wooden toys that easily splinter . dont buy wired balls . these pose a risk of your guinea pig getting their head stuck inside . never use exercise wheels or balls . there are many objects or toys that you can give guinea pigs , but you must ensure they are free of toxins or dyes . for instance , you can provide your guinea pig a manufactured house or igloo to hide in , but it must be made of edible or nontoxic materials . likewise , you can give your guinea pig balls of printer paper , but only if they are blank and do not have printer ink on them . consult your vet if you are unsure whether or not a given toy or product contains substances that could prove toxic to your guinea pig . the proper way to pick up a piggie is by placing one hand over its chest , with your index and middle fingers between its front legs and your thumb wrapped around the back of its neck . place your other hand beneath the piggies rump , with your thumb centered on its tailbone . be gentle but firm when handling . running wheels and running balls are acceptable for mice and smaller rodents , but not guinea pigs . if your piggies cage has running wheels or running balls , remove them to prevent spine and leg injuries . guinea pigs can get stuck inside of them and sometimes endangering their life . pregnant guinea pigs can easily squash their abdomen trying to squeeze into the hay rack . opt for friendlier alternatives instead such as sackscotton bags . guinea pigs like to sleep and hide in their hay which encourages them to get inside the hay rack . theres nothing wrong with having the hay on the floor .

give her extra water . feed her a high protein diet . do not hold or handle the mother . place the cage in a quiet room .

how to take care of a hamster that is giving birth 2

when you notice the mother drinking a lot more water than usual , this is a sign that she will be having her babies soon . therefore , make sure her water bottle is always full . you can also provide extra water by hanging another water bottle in her cage . when the hamster mother is close to having her babies , she will also be eating more than usual . she eats more than usual because she wants to ensure that she has enough energy for the labor process . therefore , make sure her food bowl is always stocked . it is also important to supplement her diet with extra nutrients , i . e . food that is high in protein , to help her with the pregnancy . here are some foods that you can supplement her diet withscrambled egg whites chicken or tofu porridge bread soaked in skim milk when the time for having her babies is near , the mother might become unusually aggressive . so , unless it is absolutely necessary , try not to handle or hold the mother during this time . if you do , she might bite you to let you know she is uncomfortable with being held . make sure the cage is in a quiet room , away from any loud noises in the house . loud noises can stress and disturb the mother during and after birth , which can cause her to harm her babies .

do not disturb the mother or her babies . continue to supply her with food and water . keep the mother separated .

how to take care of a hamster that is giving birth 3

you will know the mother is in labor when you hear little squeaks coming from the cage . be very careful to not intervene during this process . the mother will give birth in 10 to 30 minute intervals . either way , it can happen quickly , or take several hours . if you disturb the mother , this can cause her to stress and possibly harm one of her babies . the birthing process requires a lot of energy from the mother . make sure the mother has a constant supply of water and is continually fed a high protein diet throughout the entire process . make sure the water bottle and food bowl are easily accessible for you so you can re - supply them without disturbing the mother . do not resupply during or right after the labor process . wait a couple hours before checking and resupplying . the mother is fertile again 24 hours after birth . therefore , for the safety of the mother and her babies , do not put other hamsters back in the cage . generally , you want to minimize contact with the mother for up to two weeks . hamster babies will be mature enough to leave their mother at three to four weeks of age . if you keep the babies longer than four weeks , make sure to remove the babies from the mother before eight weeks of age . remove the babies into gender specific living groups , unless you want an explosion of hamster babies . at eight weeks , the hamsters will be able to reproduce and could possibly reproduce with the mother .

place your hamsters cage in a good location . give your hamster time to adjust to your home . approach your hamsters cage with care . stand near his cage . do not handle him . work with your hamster when he is alert . wash your hands . acclimate your hamster to your hand . pick up your hamster . hold your hamster for short periods of time . do not let your hamster fall . return your hamster to his cage .

how to make your hamster trust you

allowing your hamster to acclimate to his new environment is an important building block to gaining his trust . finding a good location for your hamsters cage will ease his acclimation . a warm room is ideal for your hamster , especially if it is draft free . the room should not be very busy with human activity—this may be bewildering or frightening to your hamster . your bedroom is usually not a good place for a hamster cage , since your hamster is nocturnal and will make a lot of noise while you sleep . give your hamster at least a few days to acclimate to his new surroundings . during this time , your hamster will start familiarizing himself with where things are in his cage food , water , sleeping area . do not be concerned if your hamster is washing his face or grooming himself excessively . these are not signs of nervous tension , as is commonly believed . rather , he is scent marking and claiming his new territory . scent marking allows your hamster to recognize places and items in his new home . your hamster will probably see you as a huge predator at first . you do not want to confirm his perception of you by approaching his cage in a threatening manner . instead , your approach should be slow and quiet , with no sudden movements or noises . try talking to him in a low and soft voice when you get near to , and reach , his cage . during those first few days of acclimation , your hamster may hide in his cage when you approach it . he may still be very wary of you and his new surroundings . over time , though , your hamster should relax enough to do normal hamster activities , such as exploring his cage , when you are nearby . talking to him in a low and soft may help him relax and be comfortable with your presence . you do not need to stand by his cage for long periods of time . try standing there for a few minutes at a time to see how he reacts to you . once you see him going about his normal business when you are nearby , continue talking to him . the sound of your voice will continue to help him adjust . consider offering him treats when you are near his cage . place them in the bottom of his cage , since he will probably not be ready to take them from your hand . it is very important that you not touch your hamster during his adjustment period . acclimating to his new home will be hard enough without you trying to handle him and pick him up . talking to him and being near his cage will be sufficient . once your hamster is adjusted to his new home and your presence , you can gain his trust by handling him properly . he will be more receptive to working with you when he is fully awake and alert , which is in the evening . do not wake your hamster up to work with him . if he is sleeping deeply , being woken up suddenly can cause him to jump into defensive mode , which could lead to you being bitten or nipped at . if he is busy doing something else when you approach his cage , get his attention by lightly tapping on the cage , moving his water bottle , or softly talking to him . clean hands are important to handling your hamster . if your hands smell like food , your hamster will see your hands as food and will probably try to bite them . be sure to wash your hands with unscented soap—even a fruit - scented soap could cause your hamster to bite your hands . if you have multiple hamsters , wash your hands between handling each one . the smell of one hamster on your hands would lead the next hamster to believe he is being attacked . your hamster will trust you when he can trust that your hands will not harm him . with your hands freshly washed , slowly place one of your hands in the bottom of his cage . allow him to explore your hand by smelling it . do not be surprised if your hamster runs and hides when you first place your hand in his cage . from his perspective as a prey animal , your hand reaching into his cage could resemble a large bird swooping down to scoop him up . rest your hand in a non - threatening way , with your fingers curled . spreading your fingers out could make your hamster think hes being attacked . do not pull your hand away if he starts to nibble on it . his nibbles are a way of exploring your hand . if you suddenly pull your hand back , you could frighten him and make him more wary of your hand . try offering him treats , talking to him , or stroking his back as he becomes more comfortable with your hand . eventually , he will take your treats from your hand . when your hamster is comfortable with your hand , slowly reach into his cage with both hands . hold your hands like a scoop and wait for your hamster to walk into your hands . support him with both hands as you slowly lift your hands out his cage . have him face you when you lift him up—he will know whats happening to him and will be less likely to jump . your hamster may become skittish and jump off your hands when your hands are still in the cage—let him do so . if he seems agitated , calm him down by giving him a treat andor stroking his back . talking to him in a soothing voice could also calm him down . your hamster may squeal when you pick him up , signaling that hes annoyed with being held . if he continues to squeal , gently place him back in his cage and try to pick him up at a later time . if you are having trouble picking him up with your hands , place an empty mug in his cage and let him climb into it . when he has crawled into the mug , gently ‘pour him out of the mug into your hands . being held by you can be stressful for your hamster . try holding him for a minute or two initially , then slowly increase the amount of time each time you pick him up . aim for handling him for about five minutes a day . hold him close to your body and stroke his back and forehead . when he is more comfortable with being held , sit or lay on the floor and let your hamster crawl and climb on you . when you pick up and hold your hamster , do not let him fall . hamsters have poor eyesight and no depth perception , so your hamster will have no sense of how or low he is from the ground . in addition , your hamster could injure himself if he gets spooked and tries to jump out of your hands when you have him out of his cage . after a few minutes , or when he begins to get agitated , place your hamster back in his cage . just as you picked him up , use slow and gentle movements to set him back in his cage . try to set your hands on the bottom of his cage before letting him out of your hands . give him a treat when you place him back in his cage .

when you first get your hamster , leave himher in their cage in a quiet room so they can get used to their surroundings . after a couple of days of not handling your hamster to ensure they feel safe in their environment , spend about an hour each day stroking your hamster and rubbing your hands around the sawdust so it can get used to your smell . watch your hamster for a few days . put food right on the cage floor . feed your hamster from the palm of your hand . get your hamster used to being picked up . take your hamster out of its cage . play with it over a table . try different types of foods so you can make it happy .

how to tame and handle a hamster

also place your hand flat in the cage so it can sniffrun over your hand when it feels brave enough do not force it do to do anything it doesnt want to as heshe will become scared and may bite . find out when it is awake and active - the best time to start taming . note its favorite foods so you can use them to overcome its fear . this way the hamster gets used to your hand and learns that it only brings food and means no harm . after a few days , leave your hand there while the hamster eats . when your hamster is confident enough to eat beside your hand , put the food in the palm of your hand . it may be some time before the hamster will eat from your hand without fear . when it does , you can stroke it gently with one finger along its back , the way the fur grows . never stroke its head . when it is eating from your hand , cup the other hand over it , and lift it gently a little way of the ground for a few moments at a time . after a few more days , if your hamster seems happy being lifted up , you can take it right out of the cage in your cupped hands . let it run from one hand to the other . soon it will be confident enough to run along your arm .

dont attempt to pick up the hamster for the first few days . use a soft , blunt object to gently stroke the hamster . wash your hands . place your hand inside the cage with a small treat in it . leave your hand inside the cage and allow the hamster to investigate . slowly cup your hands around the hamster . take your hamster outside the cage . handle your hamster at least once a day . hold your hamster securely when taking it in and out of the cage . never sneak up on your hamster . dont wake up your hamster suddenly . dont wear perfume . never squeeze your hamster . sit on the ground or hold your hamster over a tabletop . let your hamster explore nooks and crannies . clean a hamster bite carefully . gently blow on the hamsters face to discipline it .

how to pick up your hamster

bringing a hamster home to a new environment can be very stressful for the animal . allow it some time to acclimatize to its new cage and bedding . experts recommend that you dont try to handle a new hamster for the first 12 – 24 hours . this gets the hamster used to being touched making it is less likely to bite you . a q - tip or the blunt eraser end of a pencil works well for this . softly speak to your hamster while you are doing this to soothe it and let it hear your voice . repeat this several times a day for a few days . when it ignores the eraser or starts gnawing it , the hamster is ready for the next step . hamsters have very poor eyesight and use their sense of smell to interact with the world . you should wash your hands with unscented soap to remove any residual scents of food or other pets from your skin . this is especially important if you have other pets , particularly hamsters . your hamster may get the scent of another hamster from your hand and think it is being attacked by that hamster . it may bite . this engages your hamsters interest while getting it used to the presence of your hand . a very small chunk of apple works well for this . put your hand in the cage and let the hamster come up and sniff around it . let the hamster gently nibble your hands if it is not uncomfortable . this is not generally a display of aggression as hamsters like to probe and test the world around it with their teeth . repeat with different treats each time to keep the hamsters interest . it may climb on your hand , but do not try to cup your hands around the hamster or pick it up at this stage . just let your hand lie limply on the cage floor . outstretched fingers may be perceived as an attack by the hamster . do this with your hands still in the cage . keep your hands low to the ground so that if the hamster jumps out of your hand it wont fall far . cup with your bottom hand and place the other hand over the top to create a hand cave . , only do so if the hamster appears suitably relaxed in your hands . remember that being outside the cage can be very stimulating for the hamster so choose somewhere quiet with minimal distractions . if it seems agitated or starts biting , put it back in the cage and try again some other time . the more you play and pet with your hamster , the more friendly and tame it will become . neglected hamsters that have not been handled for an extended period of time can revert back to their fearful nature and may bite when picked up . you may have to go through the steps to get it used to being picked up again . put your index fingers below its neck lightly and your thumbs on top of the hamsters body . if you are wary of lifting the hamster out of the cage with bare hands , use a cup or a small bowl to get it out of the cage . disposable plastic cups work well for this . hamsters have relatively few defenses in the wild and they are wary of sudden changes in their environment . even if your hamster is tame and used to being held , dont grab it from its cage out of the blue . always allow it to see your hands for a couple of seconds first . be aware that hamsters are nocturnal . you will generally have to wake them up to play with them during the day . gently move their nest and allow them a minute to wake up . alternately , you can call softly to your hamster to wake it up . hamsters recognize you by scent . a strong perfume or cologne may confuse them . avoid strongly fruit scented soap when you wash your hands as your hamster may think your hand is food and try to bite it . hamsters , because of their small size , are extremely fragile . never ever squeeze your hamster . be particularly gentle in the area just below the forelegs . pressure to this region can prevent the hamster breathing . supervise young children when they are playing with hamsters . teach them to be gentle with the animal . hamsters can make sudden leaps from your hand and a fall to the ground from a height could injure them . make sure you are always sitting down with your hamster , so that if it escapes it will fall into your lap . alternatively , hold it over a table . in the wild , hamsters spend most of their time burrowing deep underground . hamsters like to feel hidden . they might enjoy being wrapped up in a towel in your lap or put in your shirt pocket while you watch tv . even tame hamsters will bite if they are startled or frightened . they may also bite if they have the scent of food on your hand . wash and disinfect the area around the bite and cover with bandage to stop the bleeding . if the bleeding doesnt stop or it doesnt begin to heal within a few days , go to your doctor . hamster bites are not generally serious and they do not transmit diseases such as rabies . some people can be allergic to hamster saliva , although this is relatively rare . hamsters do not respond well to physical punishment . never strike or yell at it . if a hamster bites , the best way to stop it is by gently blowing on its face . the hamster will rear back and squint because its sense of smell is affected . yelling or pulling your hand away quickly is likely to make the hamster more frightened and it may bite down harder .